NT5C2 Antibody

Images

 
Immunohistochemistry: NT5C2 Antibody [NBP1-85526] - Staining of human testis shows cytoplasmic positivity in seminiferus duct cells.

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NT5C2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KHLDSSSNERPDISSIQRRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYAASFINLLYYPFSYLFRAAHVLMPHESTVEHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLTRSISEIKPPNLFPLA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NT5C2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NT5C2 Protein (NBP1-85526PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NT5C2 Antibody

  • 5'-nucleotidase (purine), cytosolic type B
  • 5'-nucleotidase, cytosolic II
  • cN-II
  • Cytosolic 5'-nucleotidase II
  • EC 3.1.3
  • EC 3.1.3.5
  • GMP
  • NT5BIMP-specific 5'-NT
  • NT5CP
  • PNT5cytosolic purine 5'-nucleotidase
  • purine 5' nucleotidase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NBP2-43639
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-50508
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-39019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85525
Species: Hu
Applications: WB, IHC, IHC-P
H00006241-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-20231
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76775
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF6490
Species: Hu
Applications: WB, IHC, ICC
NBP1-26612
Species: Hu
Applications: IP (-), WB
MAB7330
Species: Hu
Applications: CyTOF-ready, ICFlow
MAB7446
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-46198
Species: Hu
Applications: WB, IHC
NBP1-84563
Species: Hu
Applications: Simple Western, ICC/IF, IHC, IHC-P
NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P

Publications for NT5C2 Antibody (NBP1-85526) (0)

There are no publications for NT5C2 Antibody (NBP1-85526).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NT5C2 Antibody (NBP1-85526) (0)

There are no reviews for NT5C2 Antibody (NBP1-85526). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NT5C2 Antibody (NBP1-85526) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NT5C2 Products

Bioinformatics Tool for NT5C2 Antibody (NBP1-85526)

Discover related pathways, diseases and genes to NT5C2 Antibody (NBP1-85526). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NT5C2 Antibody (NBP1-85526)

Discover more about diseases related to NT5C2 Antibody (NBP1-85526).
 

Pathways for NT5C2 Antibody (NBP1-85526)

View related products by pathway.

PTMs for NT5C2 Antibody (NBP1-85526)

Learn more about PTMs related to NT5C2 Antibody (NBP1-85526).

Blogs on NT5C2

There are no specific blogs for NT5C2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NT5C2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NT5C2