NSUN2 Antibody - BSA Free

Western Blot: NSUN2 Antibody [NBP2-94855] - Analysis of extracts of various cell lines, using NSUN2 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.

Immunocytochemistry/Immunofluorescence: NSUN2 Antibody [NBP2-94855] - Analysis of U2OS cells using NSUN2 at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: NSUN2 Antibody - BSA Free [NSUN2] - Immunofluorescence analysis of HeLa cells using NSUN2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NSUN2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NSUN2 Antibody - BSA Free (NBP2-94855) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 617-708 of human NSUN2 (NP_060225.4). SRIITVSMEDVKILLTQENPFFRKLSSETYSQAKDLAKGSIVLKYEPDSANPDALQCPIVLCGWRGKASIRTFVPKNERLHYLRMMGLEVLG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NSUN2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NSUN2 Antibody - BSA Free

• EC 2.1.1
• EC 2.1.1.29
• FLJ20303,5-methycytoisine methyltransferase
• hTrm4
• member 2
• Myc-induced SUN-domain-containing protein
• NOL1/NOP2/Sun domain family 2
• NOL1/NOP2/Sun domain family member 2
• NOP2/Sun domain family, member 2
• SAKIMisu
• Substrate of AIM1/Aurora kinase B
• TRM4MISU
• tRNA (cytosine-5-)-methyltransferase NSUN2
• tRNA (cytosine-5-)-methyltransferase
• tRNA methyltransferase 4 homolog

Background

Maturation of cytoplasmic tRNAs includes splicing of introns, which are located 1 nucleotide 3-prime from the anticodon in all intron-containing tRNA genes. In tRNA-leu(CAA), the first position of the anticodon, C34, is converted to 5-methylcytosine, a modification necessary to stabilize the anticodon-codon pairing and correctly translate the mRNA. NSUN2 encodes a methyltransferase that catalyzes the intron-dependent formation of 5-methylcytosine at C34 of tRNA-leu(CAA) (Brzezicha et al., 2006 [PubMed 17071714]).[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NSUN2