Nrf2 Antibody (1B8)

Images

 
Immunocytochemistry/ Immunofluorescence: Nrf2 Antibody (1B8) [H00004780-M03] - Analysis of monoclonal antibody to NFE2L2 on HeLa cell. Antibody concentration 10 ug/ml
ELISA: Nrf2 Antibody (1B8) [H00004780-M03] - Detection limit for recombinant GST tagged NFE2L2 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1B8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Nrf2 Antibody (1B8) Summary

Immunogen
NFE2L2 (AAH11558, 71 a.a. - 170 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCMQLLAQTFPFVDDNEVSSATFQSLVPDIPGHIESPVFIATNQAQSPETSVA
Specificity
NFE2L2 - nuclear factor (erythroid-derived 2)-like 2
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NFE2L2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00004780-M03.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Nrf2 Antibody (1B8)

  • HEBP1
  • NFE2L2
  • NF-E2-related factor 2
  • NFE2-related factor 2
  • NRF2 erythroid derived 2, like 2
  • Nrf2
  • nuclear factor (erythroid-derived 2)-like 2
  • nuclear factor erythroid 2-related factor 2
  • nuclear factor erythroid-derived 2-like 2

Background

NFE2 (MIM 601490), NFE2L1 (MIM 163260), and NFE2L2 comprise a family of human genes encoding basic leucine zipper (bZIP) transcription factors. They share highly conserved regions that are distinct from other bZIP families, such as JUN (MIM 165160) and FOS (MIM 164810), although remaining regions have diverged considerably from each other (Chan et al., 1995 [PubMed 7868116]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-03319
Species: Hu, Mu, Rt, Mk
Applications: WB, Flow, IHC, IHC-P
NB200-209
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-89533
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-82580
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-19586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00004780-M03
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for Nrf2 Antibody (H00004780-M03)(1)

Reviews for Nrf2 Antibody (H00004780-M03) (0)

There are no reviews for Nrf2 Antibody (H00004780-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Nrf2 Antibody (H00004780-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Nrf2 Products

Bioinformatics Tool for Nrf2 Antibody (H00004780-M03)

Discover related pathways, diseases and genes to Nrf2 Antibody (H00004780-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nrf2 Antibody (H00004780-M03)

Discover more about diseases related to Nrf2 Antibody (H00004780-M03).
 

Pathways for Nrf2 Antibody (H00004780-M03)

View related products by pathway.

PTMs for Nrf2 Antibody (H00004780-M03)

Learn more about PTMs related to Nrf2 Antibody (H00004780-M03).

Blogs on Nrf2.

PGC-1 alpha: Roles in Mitochondrial Biogenesis and Disease
An important aspect of mitochondria maintenance includes biogenesis to replenish damaged and degraded mitochondrial structures. The regulation of mitochondrial biogenesis is very complex and numerous genes regulate and synchronize protein synthesis fr...  Read full blog post.

Exploring the Many Roles of PGC-1 alpha
The peroxisome proliferator-activated receptor gamma, co-activator 1 (PGC-1 alpha or PPARGC1A) gene encodes a 91 kDa nuclear protein that acts as a transcriptional co-activator involved in energy metabolism. Interaction with PPAR gamma allows it to in...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nrf2 Antibody (1B8) and receive a gift card or discount.

Bioinformatics

Gene Symbol NFE2L2
Entrez
OMIM
Uniprot