NrCAM Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
Synthetic peptides corresponding to NRCAM(neuronal cell adhesion molecule) The peptide sequence was selected from the N terminal of NRCAM.
Peptide sequence NLSDTEFYGAKSSRERPPTFLTPEGNASNKEELRGNVLSLECIAEGLPTP. The peptide sequence for this immunogen was taken from within the described region. |
| Marker |
Neuronal Marker |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NRCAM |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:10-1:500
- Immunohistochemistry-Paraffin 1:10-1:500
- Western Blot 1.0 ug/ml
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
1 mg/ml |
| Purity |
Protein A purified |
Alternate Names for NrCAM Antibody - BSA Free
Background
Cell adhesion molecules (CAMs) are members of the immunoglobulin superfamily. NRCAM is a neuronal cell adhesion molecule with multiple immunoglobulin-like C2-type domains and fibronectin type-III domains. This ankyrin-binding protein is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. NRCAM may also play a general role in cell-cell communication via signaling from its intracellular domain to the actin cytoskeleton during directional cell migration. Allelic variants of its gene have been associated with autism and addiction vulnerability.Cell adhesion molecules (CAMs) are members of the immunoglobulin superfamily. This gene encodes a neuronal cell adhesion molecule with multiple immunoglobulin-like C2-type domains and fibronectin type-III domains. This ankyrin-binding protein is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. This gene is also expressed in non-neural tissues and may play a general role in cell-cell communication via signaling from its intracellular domain to the actin cytoskeleton during directional cell migration. Allelic variants of this gene have been associated with autism and addiction vulnerability. Alternative splicing results in multiple transcript variants encoding different isoforms.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, Neut, Simple Western, WB
Species: Hu
Applications: IP, Neut, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: IHC, WB
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA
Publications for NrCAM Antibody (NBP1-59501) (0)
There are no publications for NrCAM Antibody (NBP1-59501).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NrCAM Antibody (NBP1-59501) (0)
There are no reviews for NrCAM Antibody (NBP1-59501).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NrCAM Antibody (NBP1-59501). (Showing 1 - 2 of 2 FAQ).
-
I have purchased the anti-NRCAM antibody (NBP1-59501) from your company. I have seen the reconstruction instruction about the antibody, and I have a question. As you have described that the Buffer is PBS and 2% Sucrose, I did not find sodium azide ect whi
- For our product NBP1-59501, we do not add any preservative to the buffer prior to lyophilization. If you would like, for extended storage, you can add some sodium azide to the reconstituted antibody to prevent contamination. We would recommend adding between 0.05-0.1%.
-
It is stated that the addition of 50% glycerol is optional for storing. Does this mean that 50% is the final concentration or we need to add 50% volume of the original volume?
- For the glycerol, this is just an optional step. We recommend adding glycerol to the full sized vial to avoid freeze thaw cycles, otherwise you can aliquot the reconstituted antibody into working units and store without the glycerol. If you do decide to add glycerol to your vial, I would recommend adding up to 50% of the total antibody volume (50ul). You can add less if desired.
Secondary Antibodies
| |
Isotype Controls
|
Additional NrCAM Products
Research Areas for NrCAM Antibody (NBP1-59501)
Find related products by research area.
|
Blogs on NrCAM