NrCAM Antibody - BSA Free

Western Blot: NrCAM Antibody [NBP1-59501] - HepG2 cell lysate, Antibody Titration: 2.5ug/ml

Immunohistochemistry-Paraffin: NrCAM Antibody [NBP1-59501] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

NrCAM Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to NRCAM(neuronal cell adhesion molecule) The peptide sequence was selected from the N terminal of NRCAM. Peptide sequence NLSDTEFYGAKSSRERPPTFLTPEGNASNKEELRGNVLSLECIAEGLPTP. The peptide sequence for this immunogen was taken from within the described region.
• Marker: Neuronal Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NRCAM
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for NrCAM Antibody - BSA Free

• Bravo
• hBravo
• KIAA0343Neuronal surface protein Bravo
• MGC138845
• MGC138846
• neuronal cell adhesion molecule
• NgCAM-related cell adhesion molecule
• ng-CAM-related
• NrCAM
• nr-CAM

Background

Cell adhesion molecules (CAMs) are members of the immunoglobulin superfamily. NRCAM is a neuronal cell adhesion molecule with multiple immunoglobulin-like C2-type domains and fibronectin type-III domains. This ankyrin-binding protein is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. NRCAM may also play a general role in cell-cell communication via signaling from its intracellular domain to the actin cytoskeleton during directional cell migration. Allelic variants of its gene have been associated with autism and addiction vulnerability.Cell adhesion molecules (CAMs) are members of the immunoglobulin superfamily. This gene encodes a neuronal cell adhesion molecule with multiple immunoglobulin-like C2-type domains and fibronectin type-III domains. This ankyrin-binding protein is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. This gene is also expressed in non-neural tissues and may play a general role in cell-cell communication via signaling from its intracellular domain to the actin cytoskeleton during directional cell migration. Allelic variants of this gene have been associated with autism and addiction vulnerability. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for NrCAM Antibody (NBP1-59501). (Showing 1 - 2 of 2 FAQ).

1. I have purchased the anti-NRCAM antibody (NBP1-59501) from your company. I have seen the reconstruction instruction about the antibody, and I have a question. As you have described that the Buffer is PBS and 2% Sucrose, I did not find sodium azide ect whi
   • For our product NBP1-59501, we do not add any preservative to the buffer prior to lyophilization. If you would like, for extended storage, you can add some sodium azide to the reconstituted antibody to prevent contamination. We would recommend adding between 0.05-0.1%.
2. It is stated that the addition of 50% glycerol is optional for storing. Does this mean that 50% is the final concentration or we need to add 50% volume of the original volume?
   • For the glycerol, this is just an optional step. We recommend adding glycerol to the full sized vial to avoid freeze thaw cycles, otherwise you can aliquot the reconstituted antibody into working units and store without the glycerol. If you do decide to add glycerol to your vial, I would recommend adding up to 50% of the total antibody volume (50ul). You can add less if desired.

Bioinformatics

• Gene Symbol: NRCAM
• Uniprot:
  • Q92823(Human)