We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

NrCAM Antibody - BSA Free

Images

 
Western Blot: NrCAM Antibody [NBP1-59501] - HepG2 cell lysate, Antibody Titration: 2.5ug/ml
Immunohistochemistry-Paraffin: NrCAM Antibody [NBP1-59501] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Concentration
1 mg/ml

Order Details

NrCAM Antibody - BSA Free Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to NRCAM(neuronal cell adhesion molecule) The peptide sequence was selected from the N terminal of NRCAM. Peptide sequence NLSDTEFYGAKSSRERPPTFLTPEGNASNKEELRGNVLSLECIAEGLPTP. The peptide sequence for this immunogen was taken from within the described region.
Marker
Neuronal Marker
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NRCAM
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
1 mg/ml
Purity
Protein A purified

Alternate Names for NrCAM Antibody - BSA Free

  • Bravo
  • hBravo
  • KIAA0343Neuronal surface protein Bravo
  • MGC138845
  • MGC138846
  • neuronal cell adhesion molecule
  • NgCAM-related cell adhesion molecule
  • ng-CAM-related
  • NrCAM
  • nr-CAM

Background

Cell adhesion molecules (CAMs) are members of the immunoglobulin superfamily. NRCAM is a neuronal cell adhesion molecule with multiple immunoglobulin-like C2-type domains and fibronectin type-III domains. This ankyrin-binding protein is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. NRCAM may also play a general role in cell-cell communication via signaling from its intracellular domain to the actin cytoskeleton during directional cell migration. Allelic variants of its gene have been associated with autism and addiction vulnerability.Cell adhesion molecules (CAMs) are members of the immunoglobulin superfamily. This gene encodes a neuronal cell adhesion molecule with multiple immunoglobulin-like C2-type domains and fibronectin type-III domains. This ankyrin-binding protein is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. This gene is also expressed in non-neural tissues and may play a general role in cell-cell communication via signaling from its intracellular domain to the actin cytoskeleton during directional cell migration. Allelic variants of this gene have been associated with autism and addiction vulnerability. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2408
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
NB100-2682
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-88582
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF3235
Species: Hu, Mu, Rt
Applications: IHC, WB
AF4439
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF904
Species: Hu, Mu, Rt
Applications: IHC, Neut, Simple Western, WB
AF2460
Species: Hu
Applications: IP, Neut, WB
NBP1-83939
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
MAB1624
Species: Mu, Rt
Applications: IHC, WB
NB110-68136
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB300-653
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-67702
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
DVC00
Species: Hu
Applications: ELISA

Publications for NrCAM Antibody (NBP1-59501) (0)

There are no publications for NrCAM Antibody (NBP1-59501).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NrCAM Antibody (NBP1-59501) (0)

There are no reviews for NrCAM Antibody (NBP1-59501). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NrCAM Antibody (NBP1-59501). (Showing 1 - 2 of 2 FAQ).

  1. I have purchased the anti-NRCAM antibody (NBP1-59501) from your company. I have seen the reconstruction instruction about the antibody, and I have a question. As you have described that the Buffer is PBS and 2% Sucrose, I did not find sodium azide ect whi
    • For our product NBP1-59501, we do not add any preservative to the buffer prior to lyophilization. If you would like, for extended storage, you can add some sodium azide to the reconstituted antibody to prevent contamination. We would recommend adding between 0.05-0.1%.
  2. It is stated that the addition of 50% glycerol is optional for storing. Does this mean that 50% is the final concentration or we need to add 50% volume of the original volume?
    • For the glycerol, this is just an optional step. We recommend adding glycerol to the full sized vial to avoid freeze thaw cycles, otherwise you can aliquot the reconstituted antibody into working units and store without the glycerol. If you do decide to add glycerol to your vial, I would recommend adding up to 50% of the total antibody volume (50ul). You can add less if desired.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NrCAM Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol NRCAM
Uniprot