NrCAM Antibody


Western Blot: NrCAM Antibody [NBP1-59490] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

NrCAM Antibody Summary

Synthetic peptides corresponding to NRCAM(neuronal cell adhesion molecule) The peptide sequence was selected from the N terminal of NRCAM. Peptide sequence PLILFLCQMISALEVPLDLVQPPTITQQSPKDYIIDPRENIVIQCEAKGK.
Neuronal Marker
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against NRCAM and was validated on Western blot.


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NrCAM Antibody

  • Bravo
  • hBravo
  • KIAA0343Neuronal surface protein Bravo
  • MGC138845
  • MGC138846
  • neuronal cell adhesion molecule
  • NgCAM-related cell adhesion molecule
  • ng-CAM-related
  • NrCAM
  • nr-CAM


Cell adhesion molecules (CAMs) are members of the immunoglobulin superfamily. NRCAM is a neuronal cell adhesion molecule with multiple immunoglobulin-like C2-type domains and fibronectin type-III domains. This ankyrin-binding protein is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. NRCAM may also play a general role in cell-cell communication via signaling from its intracellular domain to the actin cytoskeleton during directional cell migration. Allelic variants of its gene have been associated with autism and addiction vulnerability.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, Neut
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NrCAM Antibody (NBP1-59490) (0)

There are no publications for NrCAM Antibody (NBP1-59490).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NrCAM Antibody (NBP1-59490) (0)

There are no reviews for NrCAM Antibody (NBP1-59490). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NrCAM Antibody (NBP1-59490) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NrCAM Antibody Products

Related Products by Gene

Bioinformatics Tool for NrCAM Antibody (NBP1-59490)

Discover related pathways, diseases and genes to NrCAM Antibody (NBP1-59490). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NrCAM Antibody (NBP1-59490)

Discover more about diseases related to NrCAM Antibody (NBP1-59490).

Pathways for NrCAM Antibody (NBP1-59490)

View related products by pathway.

PTMs for NrCAM Antibody (NBP1-59490)

Learn more about PTMs related to NrCAM Antibody (NBP1-59490).

Blogs on NrCAM

There are no specific blogs for NrCAM, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our NrCAM Antibody and receive a gift card or discount.


Gene Symbol NRCAM

Customers Who Bought This Also Bought