NrCAM Antibody

Images

 
Western Blot: NrCAM Antibody [NBP1-59490] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit

Order Details

NrCAM Antibody Summary

Immunogen
Synthetic peptides corresponding to NRCAM(neuronal cell adhesion molecule) The peptide sequence was selected from the N terminal of NRCAM. Peptide sequence PLILFLCQMISALEVPLDLVQPPTITQQSPKDYIIDPRENIVIQCEAKGK.
Marker
Neuronal Marker
Clonality
Polyclonal
Host
Rabbit
Gene
NRCAM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against NRCAM and was validated on Western blot.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NrCAM Antibody

  • Bravo
  • hBravo
  • KIAA0343Neuronal surface protein Bravo
  • MGC138845
  • MGC138846
  • neuronal cell adhesion molecule
  • NgCAM-related cell adhesion molecule
  • ng-CAM-related
  • NrCAM
  • nr-CAM

Background

Cell adhesion molecules (CAMs) are members of the immunoglobulin superfamily. NRCAM is a neuronal cell adhesion molecule with multiple immunoglobulin-like C2-type domains and fibronectin type-III domains. This ankyrin-binding protein is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. NRCAM may also play a general role in cell-cell communication via signaling from its intracellular domain to the actin cytoskeleton during directional cell migration. Allelic variants of its gene have been associated with autism and addiction vulnerability.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-02149
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3235
Species: Hu, Mu, Rt
Applications: WB, IHC
AF4439
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF904
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, Neut
NBP1-83939
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3865
Species: Hu
Applications: WB, IHC
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-82242
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NrCAM Antibody (NBP1-59490) (0)

There are no publications for NrCAM Antibody (NBP1-59490).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NrCAM Antibody (NBP1-59490) (0)

There are no reviews for NrCAM Antibody (NBP1-59490). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NrCAM Antibody (NBP1-59490) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NrCAM Antibody Products

Related Products by Gene

Bioinformatics Tool for NrCAM Antibody (NBP1-59490)

Discover related pathways, diseases and genes to NrCAM Antibody (NBP1-59490). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NrCAM Antibody (NBP1-59490)

Discover more about diseases related to NrCAM Antibody (NBP1-59490).
 

Pathways for NrCAM Antibody (NBP1-59490)

View related products by pathway.

PTMs for NrCAM Antibody (NBP1-59490)

Learn more about PTMs related to NrCAM Antibody (NBP1-59490).

Blogs on NrCAM

There are no specific blogs for NrCAM, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol NRCAM
Entrez
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-59490 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought

NrCAM RNAi
H00004897-R01-20nmol