NrCAM Antibody


Western Blot: NrCAM Antibody [NBP1-59490] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

NrCAM Antibody Summary

Synthetic peptides corresponding to NRCAM(neuronal cell adhesion molecule) The peptide sequence was selected from the N terminal of NRCAM. Peptide sequence PLILFLCQMISALEVPLDLVQPPTITQQSPKDYIIDPRENIVIQCEAKGK.
Neuronal Marker
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against NRCAM and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NrCAM Antibody

  • Bravo
  • hBravo
  • KIAA0343Neuronal surface protein Bravo
  • MGC138845
  • MGC138846
  • neuronal cell adhesion molecule
  • NgCAM-related cell adhesion molecule
  • ng-CAM-related
  • NrCAM
  • nr-CAM


Cell adhesion molecules (CAMs) are members of the immunoglobulin superfamily. NRCAM is a neuronal cell adhesion molecule with multiple immunoglobulin-like C2-type domains and fibronectin type-III domains. This ankyrin-binding protein is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. NRCAM may also play a general role in cell-cell communication via signaling from its intracellular domain to the actin cytoskeleton during directional cell migration. Allelic variants of its gene have been associated with autism and addiction vulnerability.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Bv
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, Neut
Species: Hu
Applications: WB, IP, Neut
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB

Publications for NrCAM Antibody (NBP1-59490) (0)

There are no publications for NrCAM Antibody (NBP1-59490).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NrCAM Antibody (NBP1-59490) (0)

There are no reviews for NrCAM Antibody (NBP1-59490). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NrCAM Antibody (NBP1-59490) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NrCAM Products

Bioinformatics Tool for NrCAM Antibody (NBP1-59490)

Discover related pathways, diseases and genes to NrCAM Antibody (NBP1-59490). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NrCAM Antibody (NBP1-59490)

Discover more about diseases related to NrCAM Antibody (NBP1-59490).

Pathways for NrCAM Antibody (NBP1-59490)

View related products by pathway.

PTMs for NrCAM Antibody (NBP1-59490)

Learn more about PTMs related to NrCAM Antibody (NBP1-59490).

Blogs on NrCAM

There are no specific blogs for NrCAM, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NrCAM Antibody and receive a gift card or discount.


Gene Symbol NRCAM