NRAS Antibody - BSA Free

Western Blot: NRAS Antibody [NBP3-38443] - Western blot analysis of lysates from Mouse brain, using NRAS Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

Immunocytochemistry/ Immunofluorescence: NRAS Antibody [NBP3-38443] - Immunofluorescence analysis of C6 cells using NRAS Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: NRAS Antibody [NBP3-38443] - Immunofluorescence analysis of U2OS cells using NRAS Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: NRAS Antibody [NBP3-38443] - Immunofluorescence analysis of NIH/3T3 cells using NRAS Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Western Blot: NRAS Antibody [NBP3-38443] - Western blot analysis of various lysates using NRAS Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 10s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NRAS Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NRAS Antibody - BSA Free (NBP3-38443) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 90-189 of human NRAS (NP_002515.1).
  
  Sequence:
  FADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NRAS
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 21 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for NRAS Antibody - BSA Free

• ALPS4
• GTPase NRas
• HRAS1
• neuroblastoma RAS viral (v-ras) oncogene homolog
• N-ras protein part 4
• N-ras
• NRAS1
• NS6
• Transforming protein N-Ras
• v-ras neuroblastoma RAS viral oncogene homolog

Background

Ras (p21), a signal transducer, was first characterized as the transforming genes of Harvey & Kristen sarcoma virus (1). The Ras family (H-Ras, N-Ras, and K-Ras) regulates cell growth, differentiation and apoptosis (2). Switching from an active or resting state, Ras can either bind GTP or GDP respectively. In the triphosphate conformation, Ras will interact with GTPase activating protein (GAP) to increase its activity (3). Mutations in any of the three isoforms can convert these proteins into active oncogenes. Additionally, Ras mutations are found in 30% of all human cancer (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NRAS