NRAMP1/SLC11A1 Antibody (2G2) - Azide and BSA Free

Western Blot: NRAMP1/SLC11A1 Antibody (2G2) [H00006556-M01] - SLC11A1 monoclonal antibody (M01), clone 2G2. Analysis of SLC11A1 expression in human liver.

ELISA: NRAMP1/SLC11A1 Antibody (2G2) [H00006556-M01] - Detection limit for recombinant GST tagged SLC11A1 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu, Mu, Bv
• Applications: WB, ELISA
• Clone: 2G2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

NRAMP1/SLC11A1 Antibody (2G2) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: SLC11A1 (NP_000569.2, 308 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QAFYQKTNQAAFNICANSSLHDYAKIFPMNNATVAVDIYQGGV
• Localization: Membrane; Multi pass membrane protein.
• Specificity: SLC11A1 - solute carrier family 11 (proton-coupled divalent metal ion transporters), member 1
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SLC11A1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 23191958).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NRAMP1/SLC11A1 Antibody (2G2) - Azide and BSA Free

• natural resistance-associated macrophage protein 1
• LSH
• member 1
• NRAMP 1
• NRAMP1
• NRAMP1solute carrier family 11 (sodium/phosphate symporters), member 1
• NRAMPnatural resistance-associated macrophage protein 1
• SLC11A1
• solute carrier family 11 (proton-coupled divalent metal ion transporters)

Background

This gene is a member of the solute carrier family 11 (proton-coupled divalent metal ion transporters) family and encodes a multi-pass membrane protein. The protein functions as a divalent transition metal (iron and manganese) transporter involved in iron metabolism and host resistance to certain pathogens. Mutations in this gene have been associated with susceptibility to infectious diseases such as tuberculosis and leprosy, and inflammatory diseases such as rheumatoid arthritis and Crohn disease. Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only one has been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NRAMP1/SLC11A1 Antibody (H00006556-M01)(2)

Publications using H00006556-M01

• Hedges JF, Kimmel E, Snyder DT et al. Solute Carrier 11A1 Is Expressed by Innate Lymphocytes and Augments Their Activation. J Immunol. 2013-03-18 [PMID: 23509347]
• Guo TZ, Wei T, Shi X et al. Neuropeptide deficient mice have attenuated nociceptive, vascular, and inflammatory changes in a tibia fracture model of complex regional pain syndrome Mol Pain 2012 Nov 28 [PMID: 23191958] (WB, Mouse)

Bioinformatics

• Gene Symbol: SLC11A1
• Entrez:
  • 6556(Human)
• OMIM:
  • 600266(Human)
• Uniprot:
  • NP_000569()