NPY4R Antibody - BSA Free

Western Blot: NPY4R Antibody [NBP3-38511] - Western blot analysis of various lysates using NPY4R Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.

• Reactivity: Hu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NPY4R Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NPY4R Antibody - BSA Free (NBP3-38511) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human NPY4R (NP_005963.4).
  
  Sequence:
  MNTSHLLALLLPKSPQGENRSKPLGTPYNFSEHCQDSVDVMVFIVTSYSIETVVGVLGNLCLMCVTVRQKEKANVTNLLI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NPY4R
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 42 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NPY4R Antibody - BSA Free

• neuropeptide Y receptor type 4
• NPY4R
• NPY4RMGC116897
• pancreatic polypeptide receptor 1NPY4-R
• PP1Y4
• PPYR1

Background

NPY4R belongs to the Neuropeptide Receptor GPCR Family and may regulate central nervous system, cardiovascular, and gastrointestinal function. NPY4R has been reported to be expressed in bladder, brain, colon, endometrium, heart, lung, nasal mucosa, penis, prostate, skeletal muscle, small intestine, stomach, and vessel. ESTs have been isolated from human colon and head/neck libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NPY4R