NPY1R Antibody (3A1)

Images

 
Sandwich ELISA: NPY1R Antibody (3A1) [H00004886-M21] - Detection limit for recombinant GST tagged NPY1R is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
3A1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NPY1R Antibody (3A1) Summary

Immunogen
NPY1R (AAH36657, 1 a.a. - 384 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVPITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVYDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI
Specificity
NPY1R - neuropeptide Y receptor Y1 (3A1)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NPY1R
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NPY1R Antibody (3A1)

  • neuropeptide Y receptor type 1
  • neuropeptide Y receptor Y1
  • NPY1R
  • NPY1-R
  • NPYR
  • NPYY1

Background

Neuropeptide Y (NPY; MIM 162640) is one of the most abundant neuropeptides in the mammalian nervous system and exhibits a diverse range of important physiologic activities, including effects on psychomotor activity, food intake, regulation of central endocrine secretion, and potent vasoactive effects on the cardiovascular system. Two major subtypes of NPY (Y1 and Y2) have been defined by pharmacologic criteria. NPY receptors, such as NPY1R, have been identified in a variety of tissues, including brain, spleen, small intestine, kidney, testis, placenta, and aortic smooth muscle (Herzog et al., 1992 [PubMed 1321422]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-30038
Species: Hu, Mu, Rt, Ye
Applications: ICC/IF, IF
NBP1-89312
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-59978
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NB100-1538
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-80865
Species: Hu
Applications: IHC, IHC-P
NBP2-01437
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, IHC, IHC-P
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-37570
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
557-NT/CF
Species: Rt
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS1071
Species: Hu
Applications: IHC-P
NBP1-89515
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-85367
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq

Publications for NPY1R Antibody (H00004886-M21) (0)

There are no publications for NPY1R Antibody (H00004886-M21).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NPY1R Antibody (H00004886-M21) (0)

There are no reviews for NPY1R Antibody (H00004886-M21). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NPY1R Antibody (H00004886-M21) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NPY1R Products

Bioinformatics Tool for NPY1R Antibody (H00004886-M21)

Discover related pathways, diseases and genes to NPY1R Antibody (H00004886-M21). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NPY1R Antibody (H00004886-M21)

Discover more about diseases related to NPY1R Antibody (H00004886-M21).
 

Pathways for NPY1R Antibody (H00004886-M21)

View related products by pathway.

PTMs for NPY1R Antibody (H00004886-M21)

Learn more about PTMs related to NPY1R Antibody (H00004886-M21).

Blogs on NPY1R

There are no specific blogs for NPY1R, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NPY1R Antibody (3A1) and receive a gift card or discount.

Bioinformatics

Gene Symbol NPY1R
Entrez
Uniprot