NPL Antibody


Western Blot: NPL Antibody [NBP1-88482] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: NPL Antibody [NBP1-88482] - Staining of human cell line A-431 shows positivity in plasma membrane & vesicles.
Immunohistochemistry-Paraffin: NPL Antibody [NBP1-88482] - Staining of human adrenal gland shows distinct positivity in cortical cells.

Product Details

Product Discontinued
View other related NPL Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NPL Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:IRAEELLDGILDKIPTFQGLKFSDTDLLDFGQCVDQNRQQQFAFLFGVDEQLLSALVMGATGAVGSTYNYL
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Read Publication using NBP1-88482.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23908247)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for NPL Antibody

  • C112
  • C1orf13MGC61869
  • chromosome 1 open reading frame 13
  • DHDPS1
  • dihydrodipicolinate synthetase homolog 1
  • EC
  • MGC149582
  • N-acetylneuraminate lyase
  • N-acetylneuraminate pyruvate lyase (dihydrodipicolinate synthase)
  • N-acetylneuraminate pyruvate-lyase
  • N-acetylneuraminic acid aldolase
  • NAL
  • NALase
  • NPL1
  • Sialate lyase
  • Sialate-pyruvate lyase
  • Sialic acid aldolase
  • Sialic acid lyase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Mu, Am
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for NPL Antibody (NBP1-88482)(1)

Reviews for NPL Antibody (NBP1-88482) (0)

There are no reviews for NPL Antibody (NBP1-88482). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NPL Antibody (NBP1-88482) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NPL Products

NPL NBP1-88482

Bioinformatics Tool for NPL Antibody (NBP1-88482)

Discover related pathways, diseases and genes to NPL Antibody (NBP1-88482). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NPL Antibody (NBP1-88482)

Discover more about diseases related to NPL Antibody (NBP1-88482).

Pathways for NPL Antibody (NBP1-88482)

View related products by pathway.

PTMs for NPL Antibody (NBP1-88482)

Learn more about PTMs related to NPL Antibody (NBP1-88482).

Blogs on NPL

There are no specific blogs for NPL, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NPL Antibody and receive a gift card or discount.


Gene Symbol NPL