Recombinant Human NPIP Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human NPIP Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 97-196 of Human NPIP

Source: Wheat Germ

Amino Acid Sequence: EGIKIVLEDIFTLWRQVETKVRAKIRKMKVTTKVNRHDKINGKRKTAKEHLRKLSMKEREHGEKERQVSEAEENGKLDMKEIHTYMEMFQRAQALRRRAE

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
NPIP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NPIP Protein

  • FLJ42525
  • FLJ44848
  • nuclear pore complex interacting protein
  • nuclear pore complex-interacting protein

Background

NPIP - nuclear pore complex interacting protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59008
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB172
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NBP2-01437
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, IHC, IHC-P
NBP2-33838
Species: Hu
Applications: IHC, IHC-P
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-87088
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85367
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87094
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP2-58649
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-42342
Species: Hu
Applications: WB, Flow, IHC, IHC-Fr
NBP1-54899
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP2-00900
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13732
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-66865
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00001434-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for NPIP Partial Recombinant Protein (H00009284-Q01) (0)

There are no publications for NPIP Partial Recombinant Protein (H00009284-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NPIP Partial Recombinant Protein (H00009284-Q01) (0)

There are no reviews for NPIP Partial Recombinant Protein (H00009284-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NPIP Partial Recombinant Protein (H00009284-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for NPIP Partial Recombinant Protein (H00009284-Q01)

Discover related pathways, diseases and genes to NPIP Partial Recombinant Protein (H00009284-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NPIP Partial Recombinant Protein (H00009284-Q01)

Discover more about diseases related to NPIP Partial Recombinant Protein (H00009284-Q01).
 

Pathways for NPIP Partial Recombinant Protein (H00009284-Q01)

View related products by pathway.

PTMs for NPIP Partial Recombinant Protein (H00009284-Q01)

Learn more about PTMs related to NPIP Partial Recombinant Protein (H00009284-Q01).
 

Research Areas for NPIP Partial Recombinant Protein (H00009284-Q01)

Find related products by research area.

Blogs on NPIP

There are no specific blogs for NPIP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NPIP Antibody
NBP2-46813

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NPIP Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NPIP