ARNTL2 Antibody

Images

 
Western Blot: ARNTL2 Antibody [NBP1-69032] - Mouse Kidney lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARNTL2 Antibody Summary

Immunogen
Synthetic peptides corresponding to Arntl2 (aryl hydrocarbon receptor nuclear translocator-like 2) The peptide sequence was selected from the C terminal of Arntl2. Peptide sequence PHGPLPGDSAQLGFDVLCDSDSIDMAAFMNYLEAEGGLGDPGDFSDIQWA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARNTL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Arntl2 and was validated on Western blot.
Theoretical MW
64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 5
using
NBP1-69032 in the following application:

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ARNTL2 Antibody

  • Aryl hydrocarbon receptor nuclear translocator-like protein 2
  • Basic-helix-loop-helix-PAS protein MOP9
  • bHLHe6
  • BMAL2
  • Brain and muscle ARNT-like 2
  • Class E basic helix-loop-helix protein 6
  • CLIF
  • CYCLE-like factor
  • Member of PAS protein 9
  • MOP9
  • PAS domain-containing protein 9
  • PASD9
  • Transcription Factor BMAL2

Background

ARNTL2/CLOCK heterodimers activate E-box element (3'-CACGTG-5') transcription. Also, in umbilical vein endothelial cells, activates SERPINE1 through E-box sites. This transactivation is inhibited by PER2 and CRY1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-126
Species: Hu, Mu
Applications: WB, ChIP
NBP2-24589
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
NB100-125
Species: Hu
Applications: WB, ICC/IF
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP1-31363
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-00749
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF3764
Species: Hu, Mu
Applications: WB, IHC, ICC
NB100-1800
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P, IP
NB100-124
Species: Hu, Mu, Rt, Bv, Ft, Pm, Sh
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP
NBP1-19613
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
AF6567
Species: Hu, Mu
Applications: WB, IHC
H00008863-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-83837
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NBP1-69032
Species: Mu
Applications: WB

Publications for ARNTL2 Antibody (NBP1-69032) (0)

There are no publications for ARNTL2 Antibody (NBP1-69032).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for ARNTL2 Antibody (NBP1-69032) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-69032:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot ARNTL2 NBP1-69032
Enlarge
reviewed by:
Ngoc-Han Ha
WB Mouse 05/20/2014
View

Summary

ApplicationWestern Blot
Sample TestedMouse mammary carcinoma (whole cell lysate)
SpeciesMouse
CommentsGreat antibody with bands at expected size (~65 kDa). 1 non-specific band observed at ~130 kDa.

Blocking

Blocking Details5% dry milk in TBST, 1 hour at room temperature

Primary Anitbody

Dilution Ratio1:5000, overnight at 4 degrees

Secondary Antibody

Secondary DescriptionGoat anti-rabbit IgG, HRP
Secondary Concentration1:10000

Details

Detection NotesECL

Comments

CommentsGreat antibody with bands at expected size (~65 kDa). 1 non-specific band observed at ~130 kDa.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARNTL2 Antibody (NBP1-69032) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Ngoc-Han Ha
05/20/2014
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol ARNTL2
Uniprot