![Western Blot: ARNTL2 Antibody [NBP1-69032] - Mouse Kidney lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/fullsize2/ARNTL2-Antibody-Western-Blot-NBP1-69032-img0002.jpg "Western Blot: ARNTL2 Antibody [NBP1-69032] - Mouse Kidney lysate, concentration 0.2-1 ug/ml.")
| Reactivity | MuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Synthetic peptides corresponding to Arntl2 (aryl hydrocarbon receptor nuclear translocator-like 2) The peptide sequence was selected from the C terminal of Arntl2.
Peptide sequence PHGPLPGDSAQLGFDVLCDSDSIDMAAFMNYLEAEGGLGDPGDFSDIQWA. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ARNTL2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | This is a rabbit polyclonal antibody against Arntl2 and was validated on Western blot. |
|
| Theoretical MW | 64 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Reviewed Applications |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS & 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
-NB100-2288-img0017.jpg)
-Flow-Cytometry-NBP2-00749-img0001.jpg)
-Flow-Cytometry-NBP2-00749-img0002.jpg)
-Immunohistochemistry-Paraffin-NBP2-00749-img0004.jpg)
-Western-Blot-NB100-124-img0009.jpg)
-Western-Blot-NB100-124-img0010.jpg)
-Immunocytochemistry-Immunofluorescence-NB100-124-img0011.jpg)
-Immunofluorescence-NBP2-46005-img0001.jpg)
-Immunofluorescence-NBP2-46005-img0002.jpg)
-Immunohistochemistry-NBP2-46005-img0003.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
WB | Mouse | 05/20/2014 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Diseases for ARNTL2 Antibody (NBP1-69032)Discover more about diseases related to ARNTL2 Antibody (NBP1-69032).
| Pathways for ARNTL2 Antibody (NBP1-69032)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Serpin E1/PAI-1 [HRP]](https://images.novusbio.com/images2/Serpin_E1_DSE100_ELISA_180.jpg)
![Serpin E1/PAI-1 [HRP]](https://images.novusbio.com/images2/DATA_Serpin_E1_DSE100_ELISA_824.jpg)
![Immunocytochemistry CRY1 Antibody [Unconjugated]](https://images.novusbio.com/images2/CRY1_AF3764_Immunocytochemistry__Immunofluorescence_19530.jpg)
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_CF_720.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_CF_722.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
