Recombinant Human Noxa Protein

Images

 
SDS-Page: Recombinant Human Noxa Protein [H00005366-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human Noxa Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 136 of Human PMAIP1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MPGKKARKNAQPSPARAPAGPAGTAGTARDQAGFAIGMQLRFTRGKKLLSSSLSSSPLALPRGHEEQVQVAGSRVCYSTQEIWRQTELPAETSESDIQTLLLRNLTASKTCMRGLLQKSFLRRCTFHQFEERLHCN

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
PMAIP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
40.7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Noxa Protein

  • adult T cell leukemia-derived PMA-responsive
  • APR
  • Immediate-early-response protein APR
  • NOXAPMA-induced protein 1
  • phorbol-12-myristate-13-acetate-induced protein 1
  • Protein Noxa

Background

PMAIP1( AAH32663, 1 a.a. - 137 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56370
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-53088
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56146
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56092
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
7270-IL/CF
Species: Hu
AF860
Species: Hu, Mu
Applications: WB, Simple Western, IP
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP2-46085
Species: Hu
Applications: WB, IHC
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
H00005366-P01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for Noxa Recombinant Protein (H00005366-P01) (0)

There are no publications for Noxa Recombinant Protein (H00005366-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Noxa Recombinant Protein (H00005366-P01) (0)

There are no reviews for Noxa Recombinant Protein (H00005366-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Noxa Recombinant Protein (H00005366-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Noxa Recombinant Protein (H00005366-P01)

Discover related pathways, diseases and genes to Noxa Recombinant Protein (H00005366-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Noxa Recombinant Protein (H00005366-P01)

Discover more about diseases related to Noxa Recombinant Protein (H00005366-P01).
 

Pathways for Noxa Recombinant Protein (H00005366-P01)

View related products by pathway.

PTMs for Noxa Recombinant Protein (H00005366-P01)

Learn more about PTMs related to Noxa Recombinant Protein (H00005366-P01).
 

Research Areas for Noxa Recombinant Protein (H00005366-P01)

Find related products by research area.

Blogs on Noxa.

NOXA - a BH3-only protein balancing cell death decisions
Noxa is a BH3-only protein involved in regulating cell death decisions. Noxa is a primary p53-response gene and is upregulated in response to p53 overexpression or DNA damage. Noxa can also be induced by alternative mechanisms including through a ...  Read full blog post.

Understanding Noxa Regulation of Apoptosis
Noxa is a pro-apoptotic gene belonging to the Bcl2 protein family that is unique in that it contains only BH3 domain. The BH3-only subclass of proteins, including proteins like PUMA and Bim in addition to Noxa, regulate the remaining Bcl-2 family memb...  Read full blog post.

Customers Who Bought This Also Bought

IL-6 [Unconjugated]
7270-IL-025/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Noxa Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PMAIP1