Noxa Antibody

Images

 
Western Blot: Noxa Antibody [NBP2-48996] - Western blot analysis in human cell line HEK 293.
Immunohistochemistry-Paraffin: Noxa Antibody [NBP2-48996] - Staining of human skin shows negative cytoplasmic positivity in fibroblasts as expected.
Immunohistochemistry-Paraffin: Noxa Antibody [NBP2-48996] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Noxa Antibody [NBP2-48996] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Noxa Antibody [NBP2-48996] - Staining of human pancreas shows moderate cytoplasmic positivity in glandular cells

Product Details

Summary
Product Discontinued
View other related Noxa Primary Antibodies

Order Details


    • Catalog Number
      NBP2-48996
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Noxa Antibody Summary

Immunogen
This Noxa antibody was developed against a recombinant protein corresponding to amino acids: QEIWRQTELPAETSESDIQTLLLRNLTASKTCMRGLLQKSFLRRCTFHQFE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PMAIP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04 - 0.4 ug/mL
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
14.96 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2), 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Noxa Antibody

  • adult T cell leukemia-derived PMA-responsive
  • APR
  • Immediate-early-response protein APR
  • NOXAPMA-induced protein 1
  • phorbol-12-myristate-13-acetate-induced protein 1
  • PMA-Induced Protein 1
  • Protein Noxa

Background

Noxa, phorbol-12-myristate-13-acetate-induced protein 1, PMA-induced protein 1, PMAIP1 (Human 6 kDa and Mouse 11.6 kDa) is a Bcl2 homology 3 (BH3) domain containing protein which plays a role in the regulation of apoptosis, specifically a pro-apoptotic role. Human Noxa contains only one BH3 domain, while the mouse and rat proteins contain two BH3 domains. The human protein is encoded by Exon 1 and 3, with Exon 2 present only in two splice variants. Human Noxa splice variants lack a BH3 domain, have no known function, and are rapidly targeted for degradation (1).

Noxa mediated apoptosis may follow its transcriptional activation by p53 as part of the DNA damage response. However, Noxa expression may be induced by HIF-1 alpha under hypoxia, promoting apoptosis independently of p53 (1). Inhibition of the anti-apoptotic Bcl2 family member Myeloid cell leukemia-1 (Mcl-1) by Noxa, leads to the activation of pro-apoptotic Bcl2 homologous antagonist killer (Bak) and Bcl2 associated X (Bax) proteins, and apoptosis through the intrinsic mitochondrial pathway (2). Other BH3 only proteins such as Bim, Puma, Bad and Bid act via the same mechanism, targeting Mcl-1 and inducing Bak/Bax mediated mitochondrial outer membrane permeabilization (MOMP), cytochrome c release and caspase 9 activation (3). Overexpression of antiapoptotic Bcl2 family members is common in various types of cancer including prostate cancer. A recent study identified antiapoptotic Bcl2 proteins involved in the development of resistance towards the androgen receptor antagonist enzalutamide, which is used for the treatment of metastatic castration-resistant prostate cancer (mCRPC) (3).

References

1.Ploner, C., Kofler, R., & Villunger, A. (2008). Noxa: At the tip of the balance between life and death. Oncogene. https://doi.org/10.1038/onc.2009.46

2.Xiang, W., Yang, C. Y., & Bai, L. (2018). MCL-1 inhibition in cancer treatment. OncoTargets and Therapy. https://doi.org/10.2147/OTT.S146228

3.Pilling, A. B., & Hwang, C. (2019). Targeting prosurvival BCL2 signaling through Akt blockade sensitizes castration-resistant prostate cancer cells to enzalutamide. Prostate. https://doi.org/10.1002/pros.23843

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-76639
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-76963
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, Simple Western, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB100-56146
Species: Hu
Applications: IHC,  IHC-P, IP, WB
AF820
Species: Hu, Mu
Applications: ICC, IHC, KO, Simple Western, WB
NB100-56104
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
AF816
Species: Hu
Applications: ICC, IHC, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
AF860
Species: Hu, Mu
Applications: IP, Simple Western, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
DY1707
Species: Hu
Applications: ELISA
NBP2-46085
Species: Hu
Applications: IHC,  IHC-P, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NB100-56118
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB

Publications for Noxa Antibody (NBP2-48996) (0)

There are no publications for Noxa Antibody (NBP2-48996).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Noxa Antibody (NBP2-48996) (0)

There are no reviews for Noxa Antibody (NBP2-48996). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Noxa Antibody (NBP2-48996) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Noxa Products

Array NBP2-48996

Research Areas for Noxa Antibody (NBP2-48996)

Find related products by research area.

Blogs on Noxa.

NOXA - a BH3-only protein balancing cell death decisions
Noxa is a BH3-only protein involved in regulating cell death decisions. Noxa is a primary p53-response gene and is upregulated in response to p53 overexpression or DNA damage. Noxa can also be induced by alternative mechanisms including through a ...  Read full blog post.

Understanding Noxa Regulation of Apoptosis
Noxa is a pro-apoptotic gene belonging to the Bcl2 protein family that is unique in that it contains only BH3 domain. The BH3-only subclass of proteins, including proteins like PUMA and Bim in addition to Noxa, regulate the remaining Bcl-2 family memb...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Noxa Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PMAIP1