NOX5 Antibody - BSA Free

Western Blot: NOX5 Antibody [NBP2-84191] - Host: Rabbit. Target Name: NOX5. Sample Type: Jurkat Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Western Blot: NOX5 Antibody [NBP2-84191] - Host: Rabbit. Target: NOX5. Positive control (+): Mouse Testis (M-TE). Negative control (-): Rat Brain (R-BR). Antibody concentration: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NOX5 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human NOX5. Peptide sequence: DQAEEAQYGRFLELHMYMTSALGKNDMKAIGLQMALDLLANKEKKDSITG The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NOX5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NOX5 Antibody - BSA Free

• EC 1.6.3.-
• MGC149776
• MGC149777
• NADPH oxidase 5
• NADPH oxidase, EF-hand calcium binding domain 5
• NOX5
• NOX5A
• NOX5B

Background

NOX5 is a novel NADPH oxidase that generates superoxide and functions as a H+ channel in a Ca(2+)-dependentmanner.(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NOX5