NOX1 Antibody


Western Blot: NOX1 Antibody [NBP1-69573] - NOX1 antibody - C-terminal region validated by WB using Epithelial Colorectal Adenocarcinoma CaCO2 at 1:10.
Western Blot: NOX1 Antibody [NBP1-69573] - This Anti-NOX1 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 0.5ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

NOX1 Antibody Summary

Synthetic peptides corresponding to NOX1(NADPH oxidase 1) The peptide sequence was selected from the C terminal of human NOX1. Peptide sequence STIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against NOX1 and was validated on Western blot.
Theoretical MW
65 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Read Publications using
NBP1-69573 in the following applications:

  • WB
    3 publications

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NOX1 Antibody

  • EC 1.6.3
  • GP91-2
  • Mitogenic oxidase 1
  • MOX-1
  • MOX1NADH/NADPH mitogenic oxidase subunit P65-MOX
  • NADPH oxidase 1
  • NADPH oxidase homolog-1
  • NOH1mitogenic oxidase (pyridine nucleotide-dependent superoxide-generating)
  • NOH-1NADPH oxidase 1 variant NOH-1L
  • NOX-1


Voltage-gated proton (hydrogen) channels play an important role in cellular defense against acidic stress. They are unique among ion channels with respect to their extremely high selectivity, marked temperature dependence, and unitary conductance, which is 3 orders of magnitude lower than that of most other ion channels. NOX1 is a homolog of the catalytic subunit of the superoxide-generating NADPH oxidase of phagocytes, gp91phox.Voltage-gated proton (hydrogen) channels play an important role in cellular defense against acidic stress. They are unique among ion channels with respect to their extremely high selectivity, marked temperature dependence, and unitary conductance, which is 3 orders of magnitude lower than that of most other ion channels. NOX1 is a homolog of the catalytic subunit of the superoxide-generating NADPH oxidase of phagocytes, gp91phox. Three splice variants of NOX1 have been identified, NOH-1L, NOH-1S and NOH-1Lv. The NOH-1S currents were reversibly blocked by zinc, a known H+ channel inhibitor. The NOH-1S variant does not contain an electron transport chain and it is thought that H+ conductance is its main physiologic function, whereas NOH-1L may conduct H+ ions as part of its electron transport mechanism.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb, Sh
Applications: WB, IB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Po
Applications: WB, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IP
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for NOX1 Antibody (NBP1-69573)(3)

Reviews for NOX1 Antibody (NBP1-69573) (0)

There are no reviews for NOX1 Antibody (NBP1-69573). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NOX1 Antibody (NBP1-69573) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NOX1 Products

Bioinformatics Tool for NOX1 Antibody (NBP1-69573)

Discover related pathways, diseases and genes to NOX1 Antibody (NBP1-69573). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NOX1 Antibody (NBP1-69573)

Discover more about diseases related to NOX1 Antibody (NBP1-69573).

Pathways for NOX1 Antibody (NBP1-69573)

View related products by pathway.

PTMs for NOX1 Antibody (NBP1-69573)

Learn more about PTMs related to NOX1 Antibody (NBP1-69573).

Blogs on NOX1

There are no specific blogs for NOX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NOX1 Antibody and receive a gift card or discount.


Gene Symbol NOX1