Notch-2 Recombinant Protein Antigen

Images

 
There are currently no images for Notch-2 Recombinant Protein Antigen (NBP2-48913PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Notch-2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Notch-2.

Source: E. coli

Amino Acid Sequence: PGILQASPNPMLATAAPPAPVHAQHALSFSNLHEMQPLAHGASTVLPSVSQLLSHHHIVSPGSGSAGSLSRLHPVPVPADWMNRMEVNETQYNEMFGMVLAPAEGTHPGIAPQSRPPEGKHITTPREPLPPIVTFQLIPKGSIAQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NOTCH2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48913.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Notch-2 Recombinant Protein Antigen

  • AGS2
  • hN2
  • neurogenic locus notch homolog protein 2
  • Notch (Drosophila) homolog 2
  • notch 2Notch homolog 2 (Drosophila)
  • Notch homolog 2
  • Notch2
  • Notch-2

Background

Synthesized in the endoplasmic reticulum as an inactive form which is proteolytically cleaved by a furin-like convertase in the trans-Golgi network before it reaches the plasma membrane to yield an active, ligand-accessible form. Cleavage results in a C-terminal fragment N(TM) and a N-terminal fragment N(EC). Following ligand binding, it is cleaved by TNF-alpha converting enzyme (TACE) to yield a membrane-associated intermediate fragment called notch extracellular truncation (NEXT). This fragment is then cleaved by presenilin dependent gamma-secretase to release a notch-derived peptide containing the intracellular domain (NICD) from the membraneFunctions as a receptor for membrane-bound ligands Jagged1, Jagged2 and Delta1 to regulate cell-fate determination. Upon ligand activation through the released notch intracellular domain (NICD) it forms a transcriptional activator complex with RBP-J kappa and activates genes of the enhancer of split locus. Affects the implementation of differentiation, proliferation and apoptotic programs.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-78486
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, KO, WB
AF3847
Species: Hu
Applications: ICC, WB
AF1308
Species: Mu
Applications: Block, CyTOF-ready, Flow, IF, IHC, WB
NBP1-47791
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, WB
AF4079
Species: Hu
Applications: ICC, WB
1277-JG
Species: Hu
Applications: BA
AF5026
Species: Mu, Rt
Applications: IHC, WB
1726-JG
Species: Hu
Applications: BA
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-25502
Species: Ca, Hu, Mu, Rt, Ze
Applications: IHC,  IHC-P, WB
NBP1-89680
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-27174
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
236-EG
Species: Hu
Applications: BA
AF1389
Species: Mu
Applications: ICC, IHC, WB
NB100-74510
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP3-46122
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, WB
AF2567
Species: Mu
Applications: IHC, WB
NBP2-48913PEP
Species: Hu
Applications: AC

Publications for Notch-2 Recombinant Protein Antigen (NBP2-48913PEP) (0)

There are no publications for Notch-2 Recombinant Protein Antigen (NBP2-48913PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Notch-2 Recombinant Protein Antigen (NBP2-48913PEP) (0)

There are no reviews for Notch-2 Recombinant Protein Antigen (NBP2-48913PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Notch-2 Recombinant Protein Antigen (NBP2-48913PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Notch-2 Products

Research Areas for Notch-2 Recombinant Protein Antigen (NBP2-48913PEP)

Find related products by research area.

Blogs on Notch-2

There are no specific blogs for Notch-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Notch-2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NOTCH2