NOSTRIN Antibody

Images

 
Immunohistochemistry-Paraffin: NOSTRIN Antibody [NBP2-13667] - Staining of human salivary gland shows cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NOSTRIN Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TLENCYQSILELEKERIQLLCNNLNQYSQHISLFGQTLTTCHTQIHCAIS KIDIEKDIQAVMEETAILSTENKSEFLLTDYFEEDPNSAMDKERRKSLLK PKLLRL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NOSTRIN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NOSTRIN Protein (NBP2-13667PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NOSTRIN Antibody

  • BM247 homolog
  • DaIP2
  • endothelial nitric oxide synthase traffic inducer
  • ENOS traffic inducer
  • eNOS-trafficking inducer
  • Nitric oxide synthase traffic inducer
  • nitric oxide synthase traffickerMGC20702
  • nitric oxide synthase trafficking
  • nostrin
  • ortholog of mouse disabled 2 interacting proein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
H00051070-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-615
Species: Hu, Mu, Rt, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-76919
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1642
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-CS
NBP2-47477
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
AF1396
Species: Hu
Applications: WB
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-37401
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
AF877
Species: Hu
Applications: WB, IHC, IP
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP2-46539
Species: Hu, Rt, Ca, Mk
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NOSTRIN Antibody (NBP2-13667) (0)

There are no publications for NOSTRIN Antibody (NBP2-13667).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NOSTRIN Antibody (NBP2-13667) (0)

There are no reviews for NOSTRIN Antibody (NBP2-13667). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NOSTRIN Antibody (NBP2-13667) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NOSTRIN Products

Bioinformatics Tool for NOSTRIN Antibody (NBP2-13667)

Discover related pathways, diseases and genes to NOSTRIN Antibody (NBP2-13667). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NOSTRIN Antibody (NBP2-13667)

Discover more about diseases related to NOSTRIN Antibody (NBP2-13667).
 

Pathways for NOSTRIN Antibody (NBP2-13667)

View related products by pathway.

PTMs for NOSTRIN Antibody (NBP2-13667)

Learn more about PTMs related to NOSTRIN Antibody (NBP2-13667).

Blogs on NOSTRIN

There are no specific blogs for NOSTRIN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NOSTRIN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NOSTRIN