NOSIP Antibody

Images

 
Western Blot: NOSIP Antibody [H00051070-B01P] - Analysis of NOSIP expression in NIH/3T3.
Immunocytochemistry/ Immunofluorescence: NOSIP Antibody [H00051070-B01P] - Analysis of purified antibody to NOSIP on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: NOSIP Antibody [H00051070-B01P] - Analysis of NOSIP expression in PC-12.
Western Blot: NOSIP Antibody [H00051070-B01P] - Analysis of NOSIP expression in Jurkat.
Western Blot: NOSIP Antibody [H00051070-B01P] - Analysis of NOSIP expression in transfected 293T cell line by NOSIP polyclonal antibody. Lane 1: NOSIP transfected lysate(33.11 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NOSIP Antibody Summary

Immunogen
NOSIP (NP_057037.1, 1 a.a. - 301 a.a.) full-length human protein. MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQMKAYEKQRGTRREEQKELQRAASQDHVRGFLEKESAIVSRPLNPFTAKALSGTSPDDVQPGPSVGPPSKDKDKVLPSFWIPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTPVHFTPLDSSVDRVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLIRKDMVDPVTGDKLTDRDIIVLQRGGTGFAGSGVKLQAEKSRPVMQA
Specificity
NOSIP - nitric oxide synthase interacting protein,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
NOSIP
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. It is also useful for immunofluoresence.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NOSIP Antibody

  • CGI-25
  • eNOS interacting protein
  • eNOS-interacting protein
  • nitric oxide synthase interacting protein
  • nitric oxide synthase-interacting protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-500
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
NB100-858
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
NBP2-81749
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
NBP1-76919
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-27084
Species: Hu, Pm
Applications: IHC, IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
NBP1-76917
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-615
Species: Hu, Mu, Rt, Sh
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC, WB
QET00B
Species: Hu
Applications: ELISA
NBP2-47415
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-77685
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
H00051070-B01P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for NOSIP Antibody (H00051070-B01P) (0)

There are no publications for NOSIP Antibody (H00051070-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NOSIP Antibody (H00051070-B01P) (0)

There are no reviews for NOSIP Antibody (H00051070-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NOSIP Antibody (H00051070-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NOSIP Products

Bioinformatics Tool for NOSIP Antibody (H00051070-B01P)

Discover related pathways, diseases and genes to NOSIP Antibody (H00051070-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NOSIP Antibody (H00051070-B01P)

Discover more about diseases related to NOSIP Antibody (H00051070-B01P).
 

Pathways for NOSIP Antibody (H00051070-B01P)

View related products by pathway.

PTMs for NOSIP Antibody (H00051070-B01P)

Learn more about PTMs related to NOSIP Antibody (H00051070-B01P).

Blogs on NOSIP

There are no specific blogs for NOSIP, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NOSIP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NOSIP
Entrez
Uniprot