NORE1 Antibody - BSA Free

Western Blot: NORE1 Antibody [NBP2-57516] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.

Immunohistochemistry-Paraffin: NORE1 Antibody [NBP2-57516] - Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in cells in red pulp and white pulp.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NORE1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NORE1 Antibody - BSA Free (NBP2-57516) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EGLSRDRPSPESTLTVTFSQNVCKPVEETQRPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RASSF5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NORE1 Recombinant Protein Antigen (NBP2-57516PEP)

Reactivity Notes

Rat 81%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NORE1 Antibody - BSA Free

• Maxp1
• MGC10823
• MGC17344
• New ras effector 1
• NORE1A
• NORE1B
• NORE1RASSF3
• Rap1-binding protein
• RAPLnovel Ras effector 1
• Ras association (RalGDS/AF-6) domain family 5
• Ras association (RalGDS/AF-6) domain family member 5
• ras association domain-containing protein 5
• Ras effector-like protein
• regulator for cell adhesion and polarization enriched in lymphoid tissue
• Regulator for cell adhesion and polarization enriched in lymphoid tissues
• tumor suppressor RASSF3

Background

NORE1 (also referred to as Ras Association (RalGDS/AF-6) Domain Family Member 5) is a tumor suppressor and induces apoptosis. NORE1 is known to have interactions with HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D and HIST1H4E. NORE1 has been studied in relation to several types of cancer including lung cancer, breast cancer, clear cell renal cell carcinoma, thyroid carcinoma, and follicular thyroid carcinoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RASSF5