NOR1/OSCP1 Antibody

Images

 
Western Blot: NOR1/OSCP1 Antibody [NBP1-70659] - Titration: 0.2-1 ug/ml, Positive Control: NCI-H226 cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NOR1/OSCP1 Antibody Summary

Immunogen
Synthetic peptides corresponding to C1ORF102 The peptide sequence was selected from the N terminal of C1ORF102. Peptide sequence MSVRTLPLLFLNLGGEMLYILDQRLRAQNIPGDKARKDEWTEVDRKRVLN.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OSCP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against C1orf102 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NOR1/OSCP1 Antibody

  • C1orf102
  • NOR1
  • OSCP1 organic solute carrier partner 1

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56745
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
AF2156
Species: Hu, Mu
Applications: WB, IHC
NBP2-46246
Species: Hu
Applications: WB, IHC, IHC-P
NB200-182
Species: Hu
Applications: WB, IHC-P, IP, PLA
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC

Publications for NOR1/OSCP1 Antibody (NBP1-70659) (0)

There are no publications for NOR1/OSCP1 Antibody (NBP1-70659).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NOR1/OSCP1 Antibody (NBP1-70659) (0)

There are no reviews for NOR1/OSCP1 Antibody (NBP1-70659). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NOR1/OSCP1 Antibody (NBP1-70659) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NOR1/OSCP1 Products

Bioinformatics Tool for NOR1/OSCP1 Antibody (NBP1-70659)

Discover related pathways, diseases and genes to NOR1/OSCP1 Antibody (NBP1-70659). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NOR1/OSCP1 Antibody (NBP1-70659)

Discover more about diseases related to NOR1/OSCP1 Antibody (NBP1-70659).
 

Pathways for NOR1/OSCP1 Antibody (NBP1-70659)

View related products by pathway.

PTMs for NOR1/OSCP1 Antibody (NBP1-70659)

Learn more about PTMs related to NOR1/OSCP1 Antibody (NBP1-70659).

Blogs on NOR1/OSCP1

There are no specific blogs for NOR1/OSCP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NOR1/OSCP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OSCP1