NONO Antibody - BSA Free

Western Blot: NONO Antibody [NBP2-38727] - Analysis in human cell line NTERA-2.

Immunocytochemistry/Immunofluorescence: NONO Antibody [NBP2-38727] - Staining of human cell line HeLa shows positivity in nucleus but excluded from the nucleoli.

Immunohistochemistry-Paraffin: NONO Antibody [NBP2-38727] - Staining of human liver.

Immunohistochemistry-Paraffin: NONO Antibody [NBP2-38727] - Staining of human colon, kidney, liver and testis using Anti-NONO antibody NBP2-38727 (A) shows similar protein distribution across tissues to independent antibody NBP2-38716 (B).

Immunohistochemistry-Paraffin: NONO Antibody [NBP2-38727] - Staining of human colon.

Immunohistochemistry-Paraffin: NONO Antibody [NBP2-38727] - Staining of human testis.

Immunohistochemistry-Paraffin: NONO Antibody [NBP2-38727] - Staining of human kidney.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NONO Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NONO Antibody - BSA Free (NBP2-38727) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NONO
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NONO Protein (NBP2-38727PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NONO Antibody - BSA Free

• NMT5552 kDa subunit
• non-POU domain containing, octamer-binding
• NRB54non-POU-domain-containing, octamer-binding
• p54(nrb)

Background

Non-POU-domain-containing octamer binding protein (NONO) is a member of the DBHS (drosophila behavior, human splicing) domain-containing family and is an RNA- and DNA- binding protein. NONO and other DBHS domain-containing proteins are multifunctional and are reported to be involved in transcriptional regulation, mRNA processing, and DNA non-homologous end joining (NHEJ). NONO functions as a coregulator of the androgen receptor (AR) and also regulates cAMP transcriptional activity by interacting with gene promoter elements. NONO is also involved in pre-mRNA splicing through an interaction with U5 snRNA and can stimulate DNA nonhomologous end joining (NHEJ) through the interaction with ku70/G22p and ku80/XRCC5 dimers. Alternate names for NONO include 54 kDa nuclear RNA- and DNA-binding protein, p54 (nrb), 55 kDa nuclear protein, NMT55, DNA-binding p52/p100 complex, NRB54, P54, and P54NRB.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NONO
• Uniprot:
  • Q15233(Human)