Novus Biologicals products are now on bio-techne.com

non-muscle Myosin IIA Antibody (4H3)

Images

 
Immunocytochemistry/ Immunofluorescence: non-muscle Myosin IIA Antibody (4H3) [H00004627-M06] - Analysis of monoclonal antibody to MYH9 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: non-muscle Myosin IIA Antibody (4H3) [H00004627-M06] - Analysis of monoclonal antibody to MYH9 on formalin-fixed paraffin-embedded human ovarian cancer. Antibody concentration 0.7 ug/ml
ELISA: non-muscle Myosin IIA Antibody (4H3) [H00004627-M06] - Detection limit for recombinant GST tagged MYH9 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IP
Clone
4H3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

non-muscle Myosin IIA Antibody (4H3) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
MYH9 (NP_002464.1, 1871 a.a. ~ 1960 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE
Specificity
myosin, heavy polypeptide 9, non-muscle
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MYH9
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
  • Western Blot 1:500
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.
Publications
Read Publications using H00004627-M06.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for non-muscle Myosin IIA Antibody (4H3)

  • Cellular myosin heavy chain, type A
  • DFNA17
  • EPSTS
  • FTNSNMMHC-IIA
  • MGC104539
  • MHANMMHC II-a
  • MYH9 variant protein
  • MYH9
  • Myosin heavy chain 9
  • Myosin heavy chain, non-muscle IIa
  • myosin, heavy chain 9, non-muscle
  • myosin, heavy polypeptide 9, non-muscle
  • myosin-9
  • NMHC-II-A
  • NMMHC II-a
  • NMMHCA
  • NMMHC-A
  • NMMHC-IIA
  • Non-muscle myosin heavy chain A
  • Non-muscle myosin heavy chain IIa
  • nonmuscle myosin heavy chain II-A
  • non-muscle myosin heavy polypeptide 9
  • Non-muscle Myosin IIA

Background

The non-muscle Myosin IIA gene encodes a myosin IIA heavy chain that contains an IQ domain and a myosin head-like domain. The protein is involved in several important functions, including cytokinesis, cell motility and maintenance of cell shape. Defects in MYH9 are the cause

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89033
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-94624
Species: Mu, Rt
Applications: ICC/IF, WB
NB110-95574
Species: Bv, Hu, Mu, Pm, Rt(-)
Applications: ICC/IF, WB
MAB4470
Species: All-Multi
Applications: ICC, IHC, WB
MAB8400
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP2-38986
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF9024
Species: Mu, Rt
Applications: IHC, WB
NBP2-13961
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-54301
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC, IHC-P, WB
H00000081-M01
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP3-13591
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-38877
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP2-75624
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, MI, WB
AF3159
Species: Mu
Applications: IHC
AF5175
Species: Mu
Applications: IHC, WB

Publications for non-muscle Myosin IIA Antibody (H00004627-M06)(3)

Reviews for non-muscle Myosin IIA Antibody (H00004627-M06) (0)

There are no reviews for non-muscle Myosin IIA Antibody (H00004627-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for non-muscle Myosin IIA Antibody (H00004627-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional non-muscle Myosin IIA Products

Research Areas for non-muscle Myosin IIA Antibody (H00004627-M06)

Find related products by research area.

Blogs on non-muscle Myosin IIA

There are no specific blogs for non-muscle Myosin IIA, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our non-muscle Myosin IIA Antibody (4H3) and receive a gift card or discount.

Bioinformatics

Gene Symbol MYH9
Entrez
OMIM