non-muscle Myosin IIA Antibody (3C7) - Azide and BSA Free Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
MYH9 (NP_002464.1, 1871 a.a. ~ 1960 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE |
| Specificity |
MYH9 (3C7) |
| Isotype |
IgG2b Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
MYH9 |
| Purity |
Ascites |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Immunohistochemistry
- Immunohistochemistry-Frozen
- Sandwich ELISA
- Western Blot
|
| Application Notes |
It has been used for ELISA, WB and IF. |
| Publications |
|
Reactivity Notes
Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
Ascites |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for non-muscle Myosin IIA Antibody (3C7) - Azide and BSA Free
Background
The non-muscle Myosin IIA gene encodes a myosin IIA heavy chain that contains an IQ domain and a myosin head-like domain. The protein is involved in several important functions, including cytokinesis, cell motility and maintenance of cell shape. Defects in MYH9 are the cause
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ICC/IF, Simple Western, WB
Species: All-Multi
Applications: Flow, ICC, IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, mIF, WB
Species: Mu
Applications: IHC
Species: Mu
Applications: IHC, Simple Western, WB
Publications for non-muscle Myosin IIA Antibody (H00004627-M01)(6)
Showing Publications 1 -
6 of 6.
| Publications using H00004627-M01 |
Applications |
Species |
| Shumeng J, Farid A, Yin-Yuan H et al. An ex vivo culture model of kidney podocyte injury reveals mechanosensitive, synaptopodin-templating, sarcomere-like structures. Sci Adv. 2022-08-31 [PMID: 36044576] |
|
|
| Liang N, Hani S, Jeffrey M et al. Synaptopodin deficiency exacerbates kidney disease in a mouse model of Alport Syndrome. Am J Physiol Renal Physiol. 2021-05-24 [PMID: 34029143] |
|
|
| Liang N, Hani S, Jeffrey M et al. Synaptopodin Is Dispensable for Normal Podocyte Homeostasis but Is Protective in the Context of Acute Podocyte Injury. J Am Soc Nephrol. 2020-09-16 [PMID: 32938649] |
|
|
| Serres M, Samwer M, Truong B et al. F-Actin Interactome Reveals Vimentin as a Key Regulator of Actin Organization and Cell Mechanics in Mitosis. Dev Cell. 2020-01-09 [PMID: 31928973] |
|
|
| Diaz-Horta O, Abad C, Cengiz FB et al. Ripor2 is involved in auditory hair cell stereociliary bundle structure and orientation. J Mol Med (Berl) 2018-10-03 [PMID: 30280293] |
|
|
| Suleiman HY, Roth R, Jain S et al. Injury-induced actin cytoskeleton reorganization in podocytes revealed by super-resolution microscopy. JCI Insight 2017-08-17 [PMID: 28814668] |
|
|
Reviews for non-muscle Myosin IIA Antibody (H00004627-M01) (0)
There are no reviews for non-muscle Myosin IIA Antibody (H00004627-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for non-muscle Myosin IIA Antibody (H00004627-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional non-muscle Myosin IIA Products
Research Areas for non-muscle Myosin IIA Antibody (H00004627-M01)
Find related products by research area.
|
Blogs on non-muscle Myosin IIA