non-muscle Myosin IIA Antibody (3C7)

Images

 
Western Blot: non-muscle Myosin IIA Antibody (3C7) [H00004627-M01] - MYH9 monoclonal antibody (M01), clone 3C7 Analysis of MYH9 expression in A-431.
Immunocytochemistry/ Immunofluorescence: non-muscle Myosin IIA Antibody (3C7) [H00004627-M01] - Analysis of monoclonal antibody to MYH9 on A-431 cell. Antibody concentration 10 ug/ml.
Western Blot: non-muscle Myosin IIA Antibody (3C7) [H00004627-M01] - MYH9 monoclonal antibody (M01), clone 3C7. Analysis of MYH9 expression in NIH/3T3.
Sandwich ELISA: non-muscle Myosin IIA Antibody (3C7) [H00004627-M01] - Detection limit for recombinant GST tagged MYH9 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3C7
Clonality
Monoclonal
Host
Mouse

Order Details

non-muscle Myosin IIA Antibody (3C7) Summary

Immunogen
MYH9 (AAH11915, 131 a.a. - 220 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE
Specificity
MYH9 (3C7)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MYH9
Purity
Ascites
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Ascites

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA, WB and IF.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for non-muscle Myosin IIA Antibody (3C7)

  • Cellular myosin heavy chain, type A
  • DFNA17
  • EPSTS
  • FTNSNMMHC-IIA
  • MGC104539
  • MHANMMHC II-a
  • MYH9 variant protein
  • Myosin heavy chain 9
  • Myosin heavy chain, non-muscle IIa
  • myosin, heavy chain 9, non-muscle
  • myosin, heavy polypeptide 9, non-muscle
  • myosin-9
  • NMHC-II-A
  • NMMHCA
  • NMMHC-A
  • Non-muscle myosin heavy chain A
  • Non-muscle myosin heavy chain IIa
  • nonmuscle myosin heavy chain II-A
  • non-muscle myosin heavy polypeptide 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89033
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NB100-65675
Species: Hu, Rt, Rb
Applications: ELISA, ICC/IF, IHC, IHC-P
NB100-56461
Species: Hu
Applications: WB, Simple Western, ICC/IF
MAB8400
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-38986
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
H00000081-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-38566
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32463
Species: Hu
Applications: IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-77303
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
AF5144
Species: Hu
Applications: WB, IHC
H00004627-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF

Publications for non-muscle Myosin IIA Antibody (H00004627-M01) (0)

There are no publications for non-muscle Myosin IIA Antibody (H00004627-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for non-muscle Myosin IIA Antibody (H00004627-M01) (0)

There are no reviews for non-muscle Myosin IIA Antibody (H00004627-M01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for non-muscle Myosin IIA Antibody (H00004627-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional non-muscle Myosin IIA Antibody (3C7) Products

Related Products by Gene

Bioinformatics Tool for non-muscle Myosin IIA Antibody (H00004627-M01)

Discover related pathways, diseases and genes to non-muscle Myosin IIA Antibody (H00004627-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for non-muscle Myosin IIA Antibody (H00004627-M01)

Discover more about diseases related to non-muscle Myosin IIA Antibody (H00004627-M01).
 

Pathways for non-muscle Myosin IIA Antibody (H00004627-M01)

View related products by pathway.

PTMs for non-muscle Myosin IIA Antibody (H00004627-M01)

Learn more about PTMs related to non-muscle Myosin IIA Antibody (H00004627-M01).
 

Research Areas for non-muscle Myosin IIA Antibody (H00004627-M01)

Find related products by research area.

Blogs on non-muscle Myosin IIA

There are no specific blogs for non-muscle Myosin IIA, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our non-muscle Myosin IIA Antibody (3C7) and receive a gift card or discount.

Bioinformatics

Gene Symbol MYH9

Customers Who Bought This Also Bought