non-muscle Myosin IIA Antibody (1H6) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: non-muscle Myosin IIA Antibody (1H6) [H00004627-M05] - Analysis of monoclonal antibody to MYH9 on HeLa cell. Antibody concentration 10 ug/ml

ELISA: non-muscle Myosin IIA Antibody (1H6) [H00004627-M05] - Detection limit for recombinant GST tagged MYH9 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 1H6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

non-muscle Myosin IIA Antibody (1H6) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: MYH9 (NP_002464.1, 1871 a.a. ~ 1960 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE
• Specificity: myosin, heavy polypeptide 9, non-muscle
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MYH9
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for non-muscle Myosin IIA Antibody (1H6) - Azide and BSA Free

• Cellular myosin heavy chain, type A
• DFNA17
• EPSTS
• FTNSNMMHC-IIA
• MGC104539
• MHANMMHC II-a
• MYH9 variant protein
• MYH9
• Myosin heavy chain 9
• Myosin heavy chain, non-muscle IIa
• myosin, heavy chain 9, non-muscle
• myosin, heavy polypeptide 9, non-muscle
• myosin-9
• NMHC-II-A
• NMMHC II-a
• NMMHCA
• NMMHC-A
• NMMHC-IIA
• Non-muscle myosin heavy chain A
• Non-muscle myosin heavy chain IIa
• nonmuscle myosin heavy chain II-A
• non-muscle myosin heavy polypeptide 9
• Non-muscle Myosin IIA

Background

The non-muscle Myosin IIA gene encodes a myosin IIA heavy chain that contains an IQ domain and a myosin head-like domain. The protein is involved in several important functions, including cytokinesis, cell motility and maintenance of cell shape. Defects in MYH9 are the cause

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MYH9
• Entrez:
  • 4627(Human)
• OMIM:
  • 153640(Human)