NOMO3 Antibody (5A7) - Azide and BSA Free

Western Blot: NOMO3 Antibody (5A7) [H00408050-M03-100ug] - Detection against Immunogen (33.22 KDa)

Western Blot: NOMO3 Antibody (5A7) [H00408050-M03-100ug] - Analysis of NOMO3 expression in Jurkat.

ELISA: NOMO3 Antibody (5A7) [H00408050-M03-100ug] - Detection limit for recombinant GST tagged NOMO3 is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 5A7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

NOMO3 Antibody (5A7) - Azide and BSA Free Summary

• Immunogen: NOMO3 (NP_001004067.1, 966 a.a. ~ 1033 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TVSSLNGEPEQGVAMEAVGQNDCSIYGEDTVTDEEGKFRLRGLLPGCVYHVQLKAEGNDHIERALPHH
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: NOMO3
• Purity: Protein A or G purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A or G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NOMO3 Antibody (5A7) - Azide and BSA Free

• NODAL modulator 3
• Nomo
• pM5 protein 3
• pM5 protein, middle copy

Background

The NOMO3 gene encodes a protein originally thought to be related to the collagenase gene family. This gene is one of three highly similar genes in a duplicated region on the short arm of chromosome 16. These three genes encode closely related proteins that ma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NOMO3
• Entrez:
  • 408050(Human)
• OMIM:
  • 609159(Human)
• Uniprot:
  • NP_001004067.1(Human)