NOL7 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: NOL7 Antibody [NBP1-86736] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli & mitochondria.

Immunohistochemistry-Paraffin: NOL7 Antibody [NBP1-86736] - Staining of human rectum shows moderate nucleolar positivity in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NOL7 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EPLEEDEEGDDEFDDEAPEELTFASAQAEAREEERRVRETVRRDKTLLKEKRKRREELFIEQKKRKL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NOL7
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NOL7 Protein (NBP1-86736PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NOL7 Antibody - BSA Free

• C6orf90
• chromosome 6 open reading frame 90
• dJ223E5.2
• MGC71933
• NOP27
• nucleolar protein 7
• nucleolar protein 7, 27kDa
• Nucleolar protein of 27 kDa
• polyglutamine binding protein 3
• PQBP3
• RARG-1
• retinoic acid repressible protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NOL7