NOL6 Antibody

Images

 
Western Blot: NOL6 Antibody [H00065083-B01P] - Analysis of NOL6 expression in transfected 293T cell line by NOL6 polyclonal antibody. Lane 1: NOL6 transfected lysate(22.11 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: NOL6 Antibody [H00065083-B01P] - Analysis of purified antibody to NOL6 on HeLa cell. (antibody concentration 10 ug/ml)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NOL6 Antibody Summary

Immunogen
NOL6 (AAH08298, 1 a.a. - 200 a.a.) full-length human protein. MVIVTPQDRKNSVWTQDGPSAQILQQLVVLAAEALPMLEKQLMDPRGPGDIRTVFRPPLDIYDVLIRLSPRHIPRHRQAVDSPAASFCRGLLSQPGPSSLMPVLGYDPPQLYLTQLREAFGDLALFFYDQHGGEVIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLGEGLVQTVEARSERWTV
Specificity
NOL6 - nucleolar protein family 6 (RNA-associated),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
NOL6
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Western Blot 1:500
Application Notes
Antibody reactive against transfected lysate for western blot. It has also been used for ELISA and immunofluoresence.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NOL6 Antibody

  • bA311H10.1
  • FLJ21959
  • MGC14896
  • MGC14921
  • MGC20838
  • Nrap
  • nucleolar protein 6
  • nucleolar protein family 6 (RNA-associated)
  • Nucleolar RNA-associated protein
  • UTP22

Background

The nucleolus is a dense subnuclear membraneless organelle that assembles around clusters of rRNA genes and functions in ribosome biogenesis. This gene encodes a nucleolar RNA-associated protein that is highly conserved between species. RNase treatment of permeabilized cells indicates that the nucleolar localization is RNA dependent. Further studies suggest that the protein is associated with ribosome biogenesis through an interaction with pre-rRNA primary transcripts. Alternative splicing has been observed at this locus and two splice variants encoding distinct isoforms have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80786
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89549
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB120-11099
Species: Al, Am, Av, Bv, Ch, Fi, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, WB
NBP1-84843
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-06983
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PEP-ELISA, WB
NBP2-71601
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, ICC/IF, WB
NBP1-85541
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, WB
NBP1-48309
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-97491
Species: Bv, Ca, Ch, Gp, Ha, Hu, Pm, Mu, Po, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
AF932
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NB300-269
Species: Bv, Ce, Ch, Dr, Eq, Hu, Mu, Pl, Po, Rt, Y, Ye
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, KD, WB
MAB6896
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP2-38361
Species: Hu
Applications: IHC, IHC-P
NBP2-50465
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P
NBP1-57176
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-75477
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00065083-B01P
Species: Hu
Applications: WB, ICC/IF

Publications for NOL6 Antibody (H00065083-B01P) (0)

There are no publications for NOL6 Antibody (H00065083-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NOL6 Antibody (H00065083-B01P) (0)

There are no reviews for NOL6 Antibody (H00065083-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NOL6 Antibody (H00065083-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NOL6 Products

Bioinformatics Tool for NOL6 Antibody (H00065083-B01P)

Discover related pathways, diseases and genes to NOL6 Antibody (H00065083-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NOL6 Antibody (H00065083-B01P)

Discover more about diseases related to NOL6 Antibody (H00065083-B01P).
 

Pathways for NOL6 Antibody (H00065083-B01P)

View related products by pathway.

Blogs on NOL6

There are no specific blogs for NOL6, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NOL6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NOL6
Entrez
Uniprot