NOL6 Antibody - Azide and BSA Free

Western Blot: NOL6 Antibody [H00065083-B01P] - Analysis of NOL6 expression in transfected 293T cell line by NOL6 polyclonal antibody. Lane 1: NOL6 transfected lysate(22.11 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: NOL6 Antibody [H00065083-B01P] - Analysis of purified antibody to NOL6 on HeLa cell. (antibody concentration 10 ug/ml)

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

NOL6 Antibody - Azide and BSA Free Summary

• Immunogen: NOL6 (AAH08298, 1 a.a. - 200 a.a.) full-length human protein. MVIVTPQDRKNSVWTQDGPSAQILQQLVVLAAEALPMLEKQLMDPRGPGDIRTVFRPPLDIYDVLIRLSPRHIPRHRQAVDSPAASFCRGLLSQPGPSSLMPVLGYDPPQLYLTQLREAFGDLALFFYDQHGGEVIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLGEGLVQTVEARSERWTV
• Specificity: NOL6 - nucleolar protein family 6 (RNA-associated),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: NOL6
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactive against transfected lysate for western blot. It has also been used for ELISA and immunofluoresence.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NOL6 Antibody - Azide and BSA Free

• bA311H10.1
• FLJ21959
• MGC14896
• MGC14921
• MGC20838
• Nrap
• nucleolar protein 6
• nucleolar protein family 6 (RNA-associated)
• Nucleolar RNA-associated protein
• UTP22

Background

The nucleolus is a dense subnuclear membraneless organelle that assembles around clusters of rRNA genes and functions in ribosome biogenesis. This gene encodes a nucleolar RNA-associated protein that is highly conserved between species. RNase treatment of permeabilized cells indicates that the nucleolar localization is RNA dependent. Further studies suggest that the protein is associated with ribosome biogenesis through an interaction with pre-rRNA primary transcripts. Alternative splicing has been observed at this locus and two splice variants encoding distinct isoforms have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NOL6
• Entrez:
  • 65083(Human)
• Uniprot:
  • AAH08298(Human)