Recombinant Human NOL4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NOL4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 425-524 of Human NOL4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PGSQDVLYINGNGTYSYHSYRGLGGGLLNLNDASSSGPTDLSMKRQLATSSGSSSSSNSRPQLSPTEINAVRQLVAGYRESAAFLLRSADELENLILQQN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
NOL4
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NOL4 Protein

  • CT125
  • HRIHFB2255
  • NOLPcancer/testis antigen 125
  • nucleolar localized protein
  • nucleolar protein 4
  • Nucleolar-localized protein

Background

NOL4 - nucleolar protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86225
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90091
Species: Hu
Applications: IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB5277
Species: Hu
Applications: WB, IHC
NBP1-84929
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-182
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP1-89707
Species: Hu
Applications: IHC, IHC-P
H00001846-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-14016
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4160
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-14114
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2045
Species: Hu
Applications: WB, IHC, ICC
NBP1-85269
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89314
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88875
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
PP-A8620A-00
Species: Hu, Mu
Applications: WB, IHC, IP, DirELISA
H00002027-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi

Publications for NOL4 Partial Recombinant Protein (H00008715-Q01) (0)

There are no publications for NOL4 Partial Recombinant Protein (H00008715-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NOL4 Partial Recombinant Protein (H00008715-Q01) (0)

There are no reviews for NOL4 Partial Recombinant Protein (H00008715-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NOL4 Partial Recombinant Protein (H00008715-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NOL4 Products

Bioinformatics Tool for NOL4 Partial Recombinant Protein (H00008715-Q01)

Discover related pathways, diseases and genes to NOL4 Partial Recombinant Protein (H00008715-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NOL4 Partial Recombinant Protein (H00008715-Q01)

Discover more about diseases related to NOL4 Partial Recombinant Protein (H00008715-Q01).
 

Pathways for NOL4 Partial Recombinant Protein (H00008715-Q01)

View related products by pathway.

PTMs for NOL4 Partial Recombinant Protein (H00008715-Q01)

Learn more about PTMs related to NOL4 Partial Recombinant Protein (H00008715-Q01).

Blogs on NOL4

There are no specific blogs for NOL4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NOL4 Antibody
NBP1-57244
ENO3 Antibody (5D1)
H00002027-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NOL4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NOL4