Nogo B receptor Antibody

Images

 
Immunohistochemistry-Paraffin: Nogo B receptor Antibody [NBP1-88252] - Staining of human rectum shows distinct positivity in blood vessels and adipocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Nogo B receptor Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ASLLSSNGCPDPDLVLKFGPVDSTLGFLPWHIRLTEIVSLPSHLNISYEDFFSALRQYAACEQRLGK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NUS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Nogo B receptor Protein (NBP1-88252PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Nogo B receptor Antibody

  • C6orf68MGC117249
  • chromosome 6 open reading frame 68
  • MGC:7199
  • MGC7199
  • NgBR
  • nogo-B receptor
  • nuclear undecaprenyl pyrophosphate synthase 1 homolog (S. cerevisiae)
  • Nuclear undecaprenyl pyrophosphate synthase 1 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84012
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56681
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC-P
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P
AF1440
Species: Mu
Applications: WB
NBP1-31475
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16984
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-33380
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
MAB9350
Species: Hu
Applications: WB, IHC, IHC-P
H00001434-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
8457-AS
Species: Hu
NB100-62239
Species: Hu
Applications: ELISA, IHC-P, RIA
NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86635
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88252
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Nogo B receptor Antibody (NBP1-88252) (0)

There are no publications for Nogo B receptor Antibody (NBP1-88252).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nogo B receptor Antibody (NBP1-88252) (0)

There are no reviews for Nogo B receptor Antibody (NBP1-88252). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Nogo B receptor Antibody (NBP1-88252) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Nogo B receptor Products

Bioinformatics Tool for Nogo B receptor Antibody (NBP1-88252)

Discover related pathways, diseases and genes to Nogo B receptor Antibody (NBP1-88252). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nogo B receptor Antibody (NBP1-88252)

Discover more about diseases related to Nogo B receptor Antibody (NBP1-88252).
 

Pathways for Nogo B receptor Antibody (NBP1-88252)

View related products by pathway.

PTMs for Nogo B receptor Antibody (NBP1-88252)

Learn more about PTMs related to Nogo B receptor Antibody (NBP1-88252).
 

Research Areas for Nogo B receptor Antibody (NBP1-88252)

Find related products by research area.

Blogs on Nogo B receptor

There are no specific blogs for Nogo B receptor, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nogo B receptor Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NUS1