NOC3L Antibody


Immunocytochemistry/ Immunofluorescence: NOC3L Antibody [NBP2-58021] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

NOC3L Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GSGALKPELSRRSATELFEAYSMAEMTFNPPVESSNPKIKGKFLQGDSFLNEDLNQLIKRYSSEVATES
Specificity of human NOC3L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Mouse 80%, Rat 83%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for NOC3L Antibody

  • AD24NOC3-like protein
  • C10orf117
  • chromosome 10 open reading frame 117
  • Factor for adipocyte differentiation 24
  • FAD24NOC3 protein homolog
  • FLJ12820
  • nucleolar complex associated 3 homolog (S. cerevisiae)
  • nucleolar complex protein 3 homolog
  • Nucleolar complex-associated protein 3-like protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha, Mk
Applications: WB, Simple Western, IHC
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, ICC
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze, Dr(-)
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ChIP
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu, Rb
Applications: WB, Flow, IHC-P, KO
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: ICC/IF

Publications for NOC3L Antibody (NBP2-58021) (0)

There are no publications for NOC3L Antibody (NBP2-58021).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NOC3L Antibody (NBP2-58021) (0)

There are no reviews for NOC3L Antibody (NBP2-58021). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NOC3L Antibody (NBP2-58021) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional NOC3L Products

Array NBP2-58021

Bioinformatics Tool for NOC3L Antibody (NBP2-58021)

Discover related pathways, diseases and genes to NOC3L Antibody (NBP2-58021). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NOC3L Antibody (NBP2-58021)

Discover more about diseases related to NOC3L Antibody (NBP2-58021).

Pathways for NOC3L Antibody (NBP2-58021)

View related products by pathway.

Research Areas for NOC3L Antibody (NBP2-58021)

Find related products by research area.

Blogs on NOC3L

There are no specific blogs for NOC3L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NOC3L Antibody and receive a gift card or discount.


Gene Symbol NOC3L