NOC3L Antibody

Images

 
Western Blot: NOC3L Antibody [NBP2-55900] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: NOC3L Antibody [NBP2-55900] - Staining of human cell line U-251 MG shows localization to nucleoli.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NOC3L Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DDLQLMKDLGQRVSFLTRDLSSSEPVHAKKRKHERIIDKYEKIPRTLQTAPEKELIHLLPIKDKSGIIPQTREKPV
Specificity
Specificity of human NOC3L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NOC3L
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Mouse 89%, Rat 89%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for NOC3L Antibody

  • AD24NOC3-like protein
  • C10orf117
  • chromosome 10 open reading frame 117
  • Factor for adipocyte differentiation 24
  • FAD24NOC3 protein homolog
  • FLJ12820
  • nucleolar complex associated 3 homolog (S. cerevisiae)
  • nucleolar complex protein 3 homolog
  • Nucleolar complex-associated protein 3-like protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92161
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha, Mk
Applications: WB, Simple Western, IHC
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-02665
Species: Hu, Rt, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, ICC
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze, Dr(-)
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ChIP
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB100-56583
Species: Hu, Rb
Applications: WB, Flow, IHC-P, KO
NBP2-45622
Species: Hu
Applications: WB, IHC
NBP1-91499
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB, ICC/IF, IHC
NBP1-59782
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb
Applications: WB
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-55900
Species: Hu
Applications: WB, ICC/IF

Publications for NOC3L Antibody (NBP2-55900) (0)

There are no publications for NOC3L Antibody (NBP2-55900).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NOC3L Antibody (NBP2-55900) (0)

There are no reviews for NOC3L Antibody (NBP2-55900). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NOC3L Antibody (NBP2-55900) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NOC3L Products

Array NBP2-55900

Bioinformatics Tool for NOC3L Antibody (NBP2-55900)

Discover related pathways, diseases and genes to NOC3L Antibody (NBP2-55900). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NOC3L Antibody (NBP2-55900)

Discover more about diseases related to NOC3L Antibody (NBP2-55900).
 

Pathways for NOC3L Antibody (NBP2-55900)

View related products by pathway.

Research Areas for NOC3L Antibody (NBP2-55900)

Find related products by research area.

Blogs on NOC3L

There are no specific blogs for NOC3L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NOC3L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NOC3L