NOC2L Antibody


Immunocytochemistry/ Immunofluorescence: NOC2L Antibody [NBP2-56871] - Staining of human cell line MCF7 shows localization to nucleoli.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

NOC2L Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LLGKVQENSAYICSRRQRVSFGVSEQQAVEAWEKLTREEGTPLTLYYSHWRKLRDREIQLEISGKERLEDLNFPEIKRRKMADRKDEDRKQFKDLFDLNSS
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NOC2L Recombinant Protein Antigen (NBP2-56871PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for NOC2L Antibody

  • DKFZP564C186
  • FLJ35172
  • NET15
  • NET7
  • NIR
  • NOC2-like protein
  • novel INHAT (inhibitor of histone acetyltransferase) repressor
  • nucleolar complex associated 2 homolog (S. cerevisiae)
  • nucleolar complex protein 2 homolog
  • Protein NOC2 homolog


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, PEP-ELISA
Species: Hu, Mu, Rt, Av, Bv, Ma, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
Species: Mu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, ELISA, IHC, Neut
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF

Publications for NOC2L Antibody (NBP2-56871) (0)

There are no publications for NOC2L Antibody (NBP2-56871).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NOC2L Antibody (NBP2-56871) (0)

There are no reviews for NOC2L Antibody (NBP2-56871). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NOC2L Antibody (NBP2-56871) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional NOC2L Products

Bioinformatics Tool for NOC2L Antibody (NBP2-56871)

Discover related pathways, diseases and genes to NOC2L Antibody (NBP2-56871). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NOC2L Antibody (NBP2-56871)

Discover more about diseases related to NOC2L Antibody (NBP2-56871).

Pathways for NOC2L Antibody (NBP2-56871)

View related products by pathway.

PTMs for NOC2L Antibody (NBP2-56871)

Learn more about PTMs related to NOC2L Antibody (NBP2-56871).

Blogs on NOC2L

There are no specific blogs for NOC2L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NOC2L Antibody and receive a gift card or discount.


Gene Symbol NOC2L