NOC2L Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NOC2L Antibody [NBP2-56871] - Staining of human cell line MCF7 shows localization to nucleoli.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NOC2L Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LLGKVQENSAYICSRRQRVSFGVSEQQAVEAWEKLTREEGTPLTLYYSHWRKLRDREIQLEISGKERLEDLNFPEIKRRKMADRKDEDRKQFKDLFDLNSS
Specificity
Specificity of human NOC2L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NOC2L
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NOC2L Recombinant Protein Antigen (NBP2-56871PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for NOC2L Antibody

  • DKFZP564C186
  • FLJ35172
  • NET15
  • NET7
  • NIR
  • NOC2-like protein
  • novel INHAT (inhibitor of histone acetyltransferase) repressor
  • nucleolar complex associated 2 homolog (S. cerevisiae)
  • nucleolar complex protein 2 homolog
  • Protein NOC2 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1034
Species: Mu, Rt
Applications: WB, Simple Western, IHC
AF2340
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
AF3749
Species: Hu
Applications: WB, IHC
NB100-1481
Species: Hu
Applications: WB, PEP-ELISA
NBP2-61764
Species: Hu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-85540
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-85297
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-56244
Species: Hu
Applications: WB, ICC/IF
NBP1-31661
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB7330
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP1-76775
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
AF1280
Species: Mu
Applications: WB, Simple Western, IHC
AF1195
Species: Hu
Applications: WB, ELISA, IHC, Neut
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for NOC2L Antibody (NBP2-56871) (0)

There are no publications for NOC2L Antibody (NBP2-56871).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NOC2L Antibody (NBP2-56871) (0)

There are no reviews for NOC2L Antibody (NBP2-56871). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NOC2L Antibody (NBP2-56871) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NOC2L Products

Bioinformatics Tool for NOC2L Antibody (NBP2-56871)

Discover related pathways, diseases and genes to NOC2L Antibody (NBP2-56871). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NOC2L Antibody (NBP2-56871)

Discover more about diseases related to NOC2L Antibody (NBP2-56871).
 

Pathways for NOC2L Antibody (NBP2-56871)

View related products by pathway.

PTMs for NOC2L Antibody (NBP2-56871)

Learn more about PTMs related to NOC2L Antibody (NBP2-56871).

Blogs on NOC2L

There are no specific blogs for NOC2L, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NOC2L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NOC2L