Recombinant Human nNOS Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human nNOS Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1041 - 1150 of Human NOS1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:FPGNHEDLVNALIERLEDAPPVNQMVKVELLEERNTALGVISNWTDELRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATSEKEKQRLLVLSKGLQEYEEWKWGKNPT

Protein/Peptide Type
Partial Recombinant Protein
Gene
NOS1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human nNOS Protein

  • bNOS
  • brain
  • Constitutive NOS
  • EC 1.14.13.39
  • IHPS1
  • Neuronal NOS
  • nitric oxide synthase 1 (neuronal)
  • nNOS
  • N-NOS
  • nNOSNOS type I
  • NOS
  • NOS1
  • Peptidyl-cysteine S-nitrosylase NOS1

Background

NOS1 - nitric oxide synthase 1 (neuronal)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76917
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-76919
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-98474
Species: Hu
Applications: WB
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P

Publications for nNOS Partial Recombinant Protein (H00004842-Q01) (0)

There are no publications for nNOS Partial Recombinant Protein (H00004842-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for nNOS Partial Recombinant Protein (H00004842-Q01) (0)

There are no reviews for nNOS Partial Recombinant Protein (H00004842-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for nNOS Partial Recombinant Protein (H00004842-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional nNOS Products

Bioinformatics Tool for nNOS Partial Recombinant Protein (H00004842-Q01)

Discover related pathways, diseases and genes to nNOS Partial Recombinant Protein (H00004842-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for nNOS Partial Recombinant Protein (H00004842-Q01)

Discover more about diseases related to nNOS Partial Recombinant Protein (H00004842-Q01).
 

Pathways for nNOS Partial Recombinant Protein (H00004842-Q01)

View related products by pathway.

PTMs for nNOS Partial Recombinant Protein (H00004842-Q01)

Learn more about PTMs related to nNOS Partial Recombinant Protein (H00004842-Q01).
 

Research Areas for nNOS Partial Recombinant Protein (H00004842-Q01)

Find related products by research area.

Blogs on nNOS

There are no specific blogs for nNOS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

nNOS Antibody
NB100-858

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human nNOS Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NOS1
Entrez