NMRAL1 Antibody

Images

 
Western Blot: NMRAL1 Antibody [NBP1-83554] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: NMRAL1 Antibody [NBP1-83554] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleus.
Immunohistochemistry-Paraffin: NMRAL1 Antibody [NBP1-83554] - Staining of human rectum shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NMRAL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SVARTLLEDGTFKVRVVTRNPRKKAAKELRLQGAEVVQGDQDDQVIMELALNGAYATFIVTNYWESCSQEQEVKQGKLLADLARRLGLHYVVYS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NMRAL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NMRAL1 Protein (NBP1-83554PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NMRAL1 Antibody

  • HSCARGFLJ25918
  • NmrA-like family domain containing 1
  • nmrA-like family domain-containing protein 1
  • SDR48A1
  • short chain dehydrogenase/reductase family 48A, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-00153
Species: Hu, Rt, Bv
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBL1-09369
Species: Hu
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
H00150684-M01
Species: Hu
Applications: WB, ELISA, IP
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB100-56507
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow

Publications for NMRAL1 Antibody (NBP1-83554) (0)

There are no publications for NMRAL1 Antibody (NBP1-83554).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NMRAL1 Antibody (NBP1-83554) (0)

There are no reviews for NMRAL1 Antibody (NBP1-83554). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NMRAL1 Antibody (NBP1-83554) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NMRAL1 Products

Bioinformatics Tool for NMRAL1 Antibody (NBP1-83554)

Discover related pathways, diseases and genes to NMRAL1 Antibody (NBP1-83554). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NMRAL1 Antibody (NBP1-83554)

Discover more about diseases related to NMRAL1 Antibody (NBP1-83554).
 

Pathways for NMRAL1 Antibody (NBP1-83554)

View related products by pathway.

PTMs for NMRAL1 Antibody (NBP1-83554)

Learn more about PTMs related to NMRAL1 Antibody (NBP1-83554).

Blogs on NMRAL1

There are no specific blogs for NMRAL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NMRAL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NMRAL1