NMNAT-2 Antibody - BSA Free

Immunohistochemistry-Paraffin: NMNAT-2 Antibody [NBP2-62637] - Immunohistochemistry analysis in human testis and liver tissues using Anti-NMNAT2 antibody. Corresponding NMNAT2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: NMNAT-2 Antibody [NBP2-62637] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: NMNAT-2 Antibody [NBP2-62637] - Staining of human liver shows low expression as expected.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NMNAT-2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LLESFCIPGLWNEADMEVIVGDFGIVVVPRDAADTDRIMNHSSILRKYKNNIMVVKDDINHPMSVVSSTKSRLALQHGDGHVVD
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NMNAT2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NMNAT-2 Recombinant Protein Antigen (NBP2-62637PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for NMNAT-2 Antibody - BSA Free

• C1orf15
• chromosome 1 open reading frame 15
• EC 2.7.7.1
• EC 2.7.7.18
• KIAA0479MGC2756
• NaMN adenylyltransferase 2
• nicotinamide mononucleotide adenylyltransferase 2
• nicotinamide nucleotide adenylyltransferase 2
• Nicotinate-nucleotide adenylyltransferase 2
• NMN adenylyltransferase 2
• NMNAT2
• NMNAT-2
• PNAT2
• pyridine nucleotide adenylyltransferase 2

Background

Nicotinamide Nucleotide Adenylyltransferase 2 (NMNAT2) is a member of the nicotinamide mononucleotide adenylyltransferase (NMNAT) enzyme family. The NMNAT2 enzyme is located in the cytoplasm and is predominantly expressed in the brain; unlike other members of the NMNAT family which are ubiquitously expressed in the nucleus. NMNAT2 catalyzes the formation of NAD(+) from nicotinamide mononucleotide (NMN) and ATP. NMNAT2 will also catalyze the reverse reaction of pyrophosphorolytic cleavage of NAD(+).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NMNAT2