NMNAT-2 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: NMNAT-2 Antibody [NBP2-62637] - Immunohistochemistry analysis in human testis and liver tissues using Anti-NMNAT2 antibody. Corresponding NMNAT2 RNA-seq data ...read more
Immunohistochemistry-Paraffin: NMNAT-2 Antibody [NBP2-62637] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: NMNAT-2 Antibody [NBP2-62637] - Staining of human liver shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

NMNAT-2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LLESFCIPGLWNEADMEVIVGDFGIVVVPRDAADTDRIMNHSSILRKYKNNIMVVKDDINHPMSVVSSTKSRLALQHGDGHVVD
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NMNAT2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NMNAT-2 Recombinant Protein Antigen (NBP2-62637PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for NMNAT-2 Antibody

  • C1orf15
  • chromosome 1 open reading frame 15
  • EC 2.7.7.1
  • EC 2.7.7.18
  • KIAA0479MGC2756
  • NaMN adenylyltransferase 2
  • nicotinamide mononucleotide adenylyltransferase 2
  • nicotinamide nucleotide adenylyltransferase 2
  • Nicotinate-nucleotide adenylyltransferase 2
  • NMN adenylyltransferase 2
  • NMNAT2
  • NMNAT-2
  • PNAT2
  • pyridine nucleotide adenylyltransferase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00064802-B01P
Species: Ha, Hu
Applications: ICC/IF, WB
NBP2-27543
Species: Hu
Applications: PEP-ELISA, WB
NB100-82245
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, Simple Western, WB
DYC2510-2
Species: Hu, Mu, Rt
Applications: ELISA
NB100-381
Species: Hu
Applications: ChIP, IP, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
DAN00
Species: Hu
Applications: ELISA
NB100-2524
Species: Hu
Applications: ICC/IF, WB
NBP2-52452
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
NBP2-21037
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-17218
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
MAB1144
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
NB100-360
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC, IHC-P, IP, WB
NBP2-31361
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P

Publications for NMNAT-2 Antibody (NBP2-62637) (0)

There are no publications for NMNAT-2 Antibody (NBP2-62637).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NMNAT-2 Antibody (NBP2-62637) (0)

There are no reviews for NMNAT-2 Antibody (NBP2-62637). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NMNAT-2 Antibody (NBP2-62637) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NMNAT-2 Products

Bioinformatics Tool for NMNAT-2 Antibody (NBP2-62637)

Discover related pathways, diseases and genes to NMNAT-2 Antibody (NBP2-62637). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NMNAT-2 Antibody (NBP2-62637)

Discover more about diseases related to NMNAT-2 Antibody (NBP2-62637).
 

Pathways for NMNAT-2 Antibody (NBP2-62637)

View related products by pathway.

PTMs for NMNAT-2 Antibody (NBP2-62637)

Learn more about PTMs related to NMNAT-2 Antibody (NBP2-62637).
 

Research Areas for NMNAT-2 Antibody (NBP2-62637)

Find related products by research area.

Blogs on NMNAT-2

There are no specific blogs for NMNAT-2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NMNAT-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NMNAT2