Reactivity | HuSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Mouse |
Conjugate | Unconjugated |
Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
Immunogen | NME3 (NP_002504.2, 1 a.a. - 169 a.a.) full-length human protein. MICLVLTIFANLFPAACTGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE |
Specificity | NME3 - non-metastatic cells 3, protein expressed in, |
Isotype | IgG |
Clonality | Polyclonal |
Host | Mouse |
Gene | NME3 |
Purity | Protein A purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.4) |
Preservative | No Preservative |
Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Diseases for NME3 Antibody (H00004832-B01P)Discover more about diseases related to NME3 Antibody (H00004832-B01P).
| Pathways for NME3 Antibody (H00004832-B01P)View related products by pathway.
|
PTMs for NME3 Antibody (H00004832-B01P)Learn more about PTMs related to NME3 Antibody (H00004832-B01P).
| Research Areas for NME3 Antibody (H00004832-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | NME3 |
Entrez |
|
Uniprot |
|