NMDARA1 Antibody

Images

 
Western Blot: NMDARA1 Antibody [NBP2-85387] - Host: Rabbit. Target Name: GRINA. Antibody Dilution: 1.0ug/ml. Sample Type: NCI-H226 cell lysate
Western Blot: NMDARA1 Antibody [NBP2-85387] - Host: Rabbit. Target Name: GRINA. Sample Type: Human NCI-H226. Lane A: Primary Antibody. Lane B: Primary Antibody + Blocking Peptide. Primary Antibody Concentration: 1.0 ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NMDARA1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of NMDARA1. Peptide sequence: FPATNWDDKSIRQAFIRKVFLVLTLQLSVTLSTVSVFTFVAEVKGFVREN The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
GRINA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NMDARA1 Antibody

  • glutamate [NMDA] receptor-associated protein 1
  • glutamate receptor, ionotropic, N-methyl D-aspartate-associated protein 1(glutamate binding)
  • glutamate receptor, NMDA subtype, glutamate-binding subunit
  • HNRGW
  • LFG1
  • NMDA receptor glutamate-binding subunit
  • NMDARA1MGC99687
  • Putative MAPK-activating protein PM02
  • TMBIM3
  • transmembrane BAX inhibitor motif containing 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24713
Species: Ca, Hu, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-24919
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-852
Species: Hu, Mu
Applications: PEP-ELISA, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-80930
Species: Ch, Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB300-118
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-30785
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6590
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
NBP2-79775
Species: Hu
Applications: IHC, IHC-P, PA, WB
NBP2-20492
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-82518
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81310
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP2-02623
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-57908
Species: Hu
Applications: ICC/IF
NBP3-12487
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
AF1152
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-89334
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-69668
Species: Hu
Applications: WB
NBP2-84247
Species: Hu
Applications: WB
NBP2-85387
Species: Hu
Applications: WB

Publications for NMDARA1 Antibody (NBP2-85387) (0)

There are no publications for NMDARA1 Antibody (NBP2-85387).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NMDARA1 Antibody (NBP2-85387) (0)

There are no reviews for NMDARA1 Antibody (NBP2-85387). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NMDARA1 Antibody (NBP2-85387) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NMDARA1 Products

Bioinformatics Tool for NMDARA1 Antibody (NBP2-85387)

Discover related pathways, diseases and genes to NMDARA1 Antibody (NBP2-85387). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NMDARA1 Antibody (NBP2-85387)

Discover more about diseases related to NMDARA1 Antibody (NBP2-85387).
 

Pathways for NMDARA1 Antibody (NBP2-85387)

View related products by pathway.

Research Areas for NMDARA1 Antibody (NBP2-85387)

Find related products by research area.

Blogs on NMDARA1

There are no specific blogs for NMDARA1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NMDARA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GRINA