NMDARA1 Antibody - BSA Free

Western Blot: NMDARA1 Antibody [NBP2-85387] - Host: Rabbit. Target Name: GRINA. Antibody Dilution: 1.0ug/ml. Sample Type: NCI-H226 cell lysate

Western Blot: NMDARA1 Antibody [NBP2-85387] - Host: Rabbit. Target Name: GRINA. Sample Type: Human NCI-H226. Lane A: Primary Antibody. Lane B: Primary Antibody + Blocking Peptide. Primary Antibody Concentration: 1.0 ug/ml. Peptide Concentration: 2.0 ug/ml. Lysate Quantity: 25 ug/lane

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NMDARA1 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of NMDARA1. Peptide sequence: FPATNWDDKSIRQAFIRKVFLVLTLQLSVTLSTVSVFTFVAEVKGFVREN The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GRINA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NMDARA1 Antibody - BSA Free

• glutamate [NMDA] receptor-associated protein 1
• glutamate receptor, ionotropic, N-methyl D-aspartate-associated protein 1(glutamate binding)
• glutamate receptor, NMDA subtype, glutamate-binding subunit
• HNRGW
• LFG1
• NMDA receptor glutamate-binding subunit
• NMDARA1MGC99687
• Putative MAPK-activating protein PM02
• TMBIM3
• transmembrane BAX inhibitor motif containing 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GRINA