TMBIM1 Antibody


Western Blot: TMBIM1 Antibody [NBP1-81310] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: TMBIM1 Antibody [NBP1-81310] - Staining of human colon shows strong cytoplasmic positivity.
Western Blot: TMBIM1 Antibody [NBP1-81310] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-582

Product Details

Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

TMBIM1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GYGQPSVLPGGYPAYPGYPQPGYGHPAGYPQPMPPTHPMPMNYGPGHGYDGEERAVSDSFGPGEWDDRKVRHT
Specificity of human TMBIM1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TMBIM1 Protein (NBP1-81310PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TMBIM1 Antibody

  • LFG3
  • MST100
  • PP1201
  • Protein RECS1 homolog
  • RECS1MSTP100
  • transmembrane BAX inhibitor motif containing 1
  • transmembrane BAX inhibitor motif-containing protein 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Mu
Applications: Flow, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, IHC
Species: Mu
Applications: Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, V-Vi
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for TMBIM1 Antibody (NBP1-81310) (0)

There are no publications for TMBIM1 Antibody (NBP1-81310).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMBIM1 Antibody (NBP1-81310) (0)

There are no reviews for TMBIM1 Antibody (NBP1-81310). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMBIM1 Antibody (NBP1-81310) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional TMBIM1 Products

Bioinformatics Tool for TMBIM1 Antibody (NBP1-81310)

Discover related pathways, diseases and genes to TMBIM1 Antibody (NBP1-81310). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMBIM1 Antibody (NBP1-81310)

Discover more about diseases related to TMBIM1 Antibody (NBP1-81310).

Pathways for TMBIM1 Antibody (NBP1-81310)

View related products by pathway.

PTMs for TMBIM1 Antibody (NBP1-81310)

Learn more about PTMs related to TMBIM1 Antibody (NBP1-81310).

Blogs on TMBIM1

There are no specific blogs for TMBIM1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TMBIM1 Antibody and receive a gift card or discount.


Gene Symbol TMBIM1