NMDAR2A Antibody

Images

 
There are currently no images for NMDAR2A Antibody (NBP3-10351).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NMDAR2A Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NMDAR2A (NP_000824). Peptide sequence DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST
Specificity
Epsilon-1 subunit
Clonality
Polyclonal
Host
Rabbit
Gene
GRIN2A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Western Blot 1.0 ug/ml
Theoretical MW
163 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for NMDAR2A Antibody

  • GluN2A
  • glutamate receptor, ionotropic, N-methyl D-aspartate 2A
  • hNR2A
  • NMDA receptor subtype 2A
  • N-methyl D-aspartate receptor subtype 2A
  • N-methyl-D-aspartate receptor subunit 2A
  • subunit epsilon-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-106
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, WB
NB300-118
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-88790
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-107
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
NBP2-94573
Species: Hu, Mu, Rt
Applications: WB
NBP2-67737
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP1-88191
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NB300-124
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP1-89765
Species: Hu
Applications: IHC, IHC-P
NB300-556
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
DBD00
Species: Hu
Applications: ELISA
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-67627
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-556
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
H00005662-B01P
Species: Hu, Rt
Applications: ICC/IF, WB
NBP2-46421
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-02312
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-00594
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB

Publications for NMDAR2A Antibody (NBP3-10351) (0)

There are no publications for NMDAR2A Antibody (NBP3-10351).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NMDAR2A Antibody (NBP3-10351) (0)

There are no reviews for NMDAR2A Antibody (NBP3-10351). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NMDAR2A Antibody (NBP3-10351) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NMDAR2A Products

Bioinformatics Tool for NMDAR2A Antibody (NBP3-10351)

Discover related pathways, diseases and genes to NMDAR2A Antibody (NBP3-10351). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NMDAR2A Antibody (NBP3-10351)

Discover more about diseases related to NMDAR2A Antibody (NBP3-10351).
 

Pathways for NMDAR2A Antibody (NBP3-10351)

View related products by pathway.

PTMs for NMDAR2A Antibody (NBP3-10351)

Learn more about PTMs related to NMDAR2A Antibody (NBP3-10351).
 

Research Areas for NMDAR2A Antibody (NBP3-10351)

Find related products by research area.

Blogs on NMDAR2A

There are no specific blogs for NMDAR2A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NMDAR2A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GRIN2A