NLRP14 Antibody

Images

 
Immunohistochemistry-Paraffin: NLRP14 Antibody [NBP1-90627] - Staining of human stomach, lower shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NLRP14 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EKAWSVSLKIFGKMNLKDLCERAKEEINWSAQTIGPDDAKAGETQEDQEAVLGDGTEYRNRIKEKFCITWDKKSLAGKPEDFHHGIAEKDRKLLEHLFDVDVK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NLRP14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NLRP14 Protein (NBP1-90627PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NLRP14 Antibody

  • CLR11.2
  • LRR and PYD containing protein 14
  • NACHT, leucine rich repeat and PYD containing 14
  • NACHT, LRR and PYD domains-containing protein 14
  • NALP14
  • NLR family, pyrin domain containing 14
  • nucleotide-binding oligomerization domain protein 5
  • nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domain containing 14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
NBP2-59072
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-Fr, IHC-P, MeDIP
NBP2-22380
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56142
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-76289
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, ICC
NB100-56152
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00344018-P01
Species: Hu
NBP2-20453
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56883
Species: Hu
Applications: ICC/IF
NB100-56156
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP2-29997
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-46193
Species: Hu
Applications: WB, IHC

Publications for NLRP14 Antibody (NBP1-90627) (0)

There are no publications for NLRP14 Antibody (NBP1-90627).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NLRP14 Antibody (NBP1-90627) (0)

There are no reviews for NLRP14 Antibody (NBP1-90627). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NLRP14 Antibody (NBP1-90627) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NLRP14 Products

Bioinformatics Tool for NLRP14 Antibody (NBP1-90627)

Discover related pathways, diseases and genes to NLRP14 Antibody (NBP1-90627). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NLRP14 Antibody (NBP1-90627)

Discover more about diseases related to NLRP14 Antibody (NBP1-90627).
 

Pathways for NLRP14 Antibody (NBP1-90627)

View related products by pathway.

Blogs on NLRP14

There are no specific blogs for NLRP14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NLRP14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NLRP14