Recombinant Human NKX2.5 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NKX2.5 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-324 of Human NKX2-5 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVGLPPPPPPPARRIAVPVLVRDGKPCLGDSAPYAPAYGVGLNPYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSPAQPATAAANNNFVNFGVGDLNAVQSPGIPQSNSGVSTLHGIRAW

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
NKX2-5

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NKX2.5 Protein

  • cardiac-specific homeo box
  • cardiac-specific homeobox 1
  • Cardiac-specific homeobox
  • CHNG5
  • CSX1
  • CSXFLJ97195
  • FLJ52202
  • FLJ99536
  • Homeobox protein CSX
  • Homeobox protein NK-2 homolog E
  • homeobox protein Nkx-2.5
  • NK2 transcription factor related, locus 5 (Drosophila)
  • NKX2.5
  • NKX2.5FLJ97166
  • NKX2-5
  • NKX2E
  • NKX2EFLJ97197
  • NKX4-1
  • tinman paralog

Background

NKX2-5( AAH25711, 1 a.a. - 325 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16613
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16613
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00493
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-83237
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
PPS046
Species: Hu, Mu, Rt, Bv, Ca, Ch, GP, Pm, Ze
Applications: WB
NBP1-87814
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
AF1837
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-89090
Species: Hu
Applications: IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
AF3876
Species: Hu, Mu
Applications: WB, IHC
NBP2-46076
Species: Hu
Applications: WB, IHC
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
NBP1-46568
Species: Mu, Rt
Applications: WB, IHC, IHC-P
MAB4028
Species: Hu, Mu
Applications: WB
H00001482-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for NKX2.5 Recombinant Protein (H00001482-P01) (0)

There are no publications for NKX2.5 Recombinant Protein (H00001482-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NKX2.5 Recombinant Protein (H00001482-P01) (0)

There are no reviews for NKX2.5 Recombinant Protein (H00001482-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NKX2.5 Recombinant Protein (H00001482-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NKX2.5 Products

Bioinformatics Tool for NKX2.5 Recombinant Protein (H00001482-P01)

Discover related pathways, diseases and genes to NKX2.5 Recombinant Protein (H00001482-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NKX2.5 Recombinant Protein (H00001482-P01)

Discover more about diseases related to NKX2.5 Recombinant Protein (H00001482-P01).
 

Pathways for NKX2.5 Recombinant Protein (H00001482-P01)

View related products by pathway.

PTMs for NKX2.5 Recombinant Protein (H00001482-P01)

Learn more about PTMs related to NKX2.5 Recombinant Protein (H00001482-P01).

Blogs on NKX2.5.

6 Fictional Character Protein Names
Check out our list of some of the funniest fictional character protein names including GOLM1, SMURF1, HOMER1, Hunchback, Lilliputian, Pokemon, Tinman Paralog, and Draculin. What are your favorite or funniest protein names? Share them in the comments;...  Read full blog post.

Customers Who Bought This Also Bought

NKX2.5 Antibody
NBP1-31558
BMP-2 [Unconjugated]
355-BM-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NKX2.5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NKX2-5
Entrez