NKTR Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: NKTR Antibody [NBP2-58423] - Staining of human cell line HeLa shows localization to nucleoplasm & plasma membrane.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NKTR Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SMSESKVLGEVGKQDSSSASLASAGESTGKKEVAEKSQINLIDKKWKPLQGVGNLAAPNAATSSAVEVKVLTTVPEMKPQGLRIEIKSKNKVRPGSLFDEV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NKTR
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NKTR Recombinant Protein Antigen (NBP2-58423PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NKTR Antibody - BSA Free

• DKFZp686F1754
• DKFZp686G0426
• DKFZp686J06106
• DKFZp686N24126
• EC 5.2.1.8
• MGC90527
• natural killer triggering receptor
• natural killer-tumor recognition sequence
• Natural-killer cells cyclophilin-related protein
• NK-TR protein
• NK-tumor recognition protein
• p104

Background

The NKTR gene encodes a membrane-anchored protein with a hydrophobic amino terminal domain and a cyclophilin-like PPIase domain. It is present on the surface of natural killer cells and facilitates their binding to targets. Its expression is regulated by IL2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NKTR