NKp80/KLRF1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

NKp80/KLRF1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NKp80/KLRF1
  
  

  Source: E. coli

  Amino Acid Sequence: GSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLKYQGKCYWFSNEMKSWSDSYVYCLER

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: KLRF1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17283.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NKp80/KLRF1 Recombinant Protein Antigen

• Activating coreceptor NKp80
• CLEC5C
• CLEC5CMGC119908
• C-type lectin domain family 5 member C
• killer cell lectin-like receptor F1
• killer cell lectin-like receptor subfamily F member 1
• killer cell lectin-like receptor subfamily F, member 1
• KLRF1
• Lectin-like receptor F1
• MGC119907
• MGC119909
• ML
• NKp80

Background

KLRF1 is a gene that codes for a protein that is helps to facilitate the natural killer-mefiated cytolysis of PHA-induced lymphoblasts and is strongly expressed in the peripheral blood leukocytes and the spleen, with a weaker expression in the lymph nodes and the adult liver. There are four isoforms of KLRF1, with lengths of 232, 182, 64, and 78 amino acids and weights of approximately 27, 21, 7, and 9 kDa respectively. There have been studies conducted on diseases and disorders relating to this gene, including hepatitis b and hepatitis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: KLRF1