NKp80/KLRF1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NKp80/KLRF1 Source: E. coli
Amino Acid Sequence: GSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLKYQGKCYWFSNEMKSWSDSYVYCLER Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
KLRF1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10-100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17283. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for NKp80/KLRF1 Recombinant Protein Antigen
Background
KLRF1 is a gene that codes for a protein that is helps to facilitate the natural killer-mefiated cytolysis of PHA-induced lymphoblasts and is strongly expressed in the peripheral blood leukocytes and the spleen, with a weaker expression in the lymph nodes and the adult liver. There are four isoforms of KLRF1, with lengths of 232, 182, 64, and 78 amino acids and weights of approximately 27, 21, 7, and 9 kDa respectively. There have been studies conducted on diseases and disorders relating to this gene, including hepatitis b and hepatitis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CostimT, CyTOF-ready, Flow, Neut, WB
Species: Mu
Applications: AgAct, CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: Block, CyTOF-ready, Flow
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: AgAct, CyTOF-reported, Flow
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: AgAct, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KD
Species: Hu
Applications: Block, Simple Western, WB
Species: Hu
Applications: Bind
Species: Hu
Applications: Block, CyTOF-reported, Flow
Species: Hu
Applications: AC
Publications for NKp80/KLRF1 Recombinant Protein Antigen (NBP3-17283PEP) (0)
There are no publications for NKp80/KLRF1 Recombinant Protein Antigen (NBP3-17283PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NKp80/KLRF1 Recombinant Protein Antigen (NBP3-17283PEP) (0)
There are no reviews for NKp80/KLRF1 Recombinant Protein Antigen (NBP3-17283PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for NKp80/KLRF1 Recombinant Protein Antigen (NBP3-17283PEP) (0)
Additional NKp80/KLRF1 Products
Research Areas for NKp80/KLRF1 Recombinant Protein Antigen (NBP3-17283PEP)
Find related products by research area.
|
Blogs on NKp80/KLRF1