NKG2D/CD314 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related NKG2D/CD314 Peptides and Proteins

Order Details


    • Catalog Number
      NBP2-56979PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NKG2D/CD314 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NKG2D/CD314.

Source: E. coli

Amino Acid Sequence: WSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNAS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KLRK1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56979.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NKG2D/CD314 Recombinant Protein Antigen

  • CD314 antigen
  • CD314
  • D12S2489E
  • FLJ17759
  • FLJ75772
  • Killer cell lectin-like receptor subfamily K member 1
  • killer cell lectin-like receptor subfamily K, member 1
  • KLR
  • KLRK1
  • NK cell receptor D
  • NKG2-D type II integral membrane protein
  • NKG2D
  • NKG2-D
  • NKG2-D-activating NK receptor
  • NKG2DDNA segment on chromosome 12 (unique) 2489 expressed sequence

Background

Natural killer group 2 member D (NKG2D), also known as killer lectin-like receptor subfamily K member 1 (KLRK1) and CD314, is a 42 kDa type II transmembrane protein belonging to the C-type lectin superfamily and is an activating receptor for NK cells (1). NKG2D is expressed on innate and adaptive immune cells such as NK cells, NKT cells, CD8+ T cells, and gammadelta T cells (1-4). Under pathological conditions, including Crohn's disease and Rheumatoid arthritis, NKG2D expression can be induced on CD4+ cells (2,3). NKG2D is synthesized as a protein of 216 amino acids (aa) in length with a theoretical molecular weight of 25.3 kDa (5). The full NKG2D receptor is expressed on the cell surface as a disulfide-linked homodimer and, in humans, has several ligands expressed on tumor cells including MHC class I-related genes A and B (MICA and MICB) and 6 members of the UL16-binding protein (ULBP) family (1-4, 6). NKG2D interaction with its ligand results in activation of NK cells via the recruitment of adapter molecules DNAX-activating protein of 10 kDa (DAP10) or DAP12 homodimers to the intracellular tail region of NKG2D (1-4, 6). In humans, NKG2D can only bind DAP10; however, mice have both short and long NKG2D isoforms which can also bind DAP12 (2-4, 6). Following NKG2D receptor and ligand interaction, the YXXM motif of the DAP10 adapter molecule initiates a downstream signaling cascade through Grb2 and PI3K pathways, resulting in NK cell cytotoxicity (4,6).

In general, NKG2D signaling has dual functions, playing a role in both immune surveillance and immune escape (4,6). Detection of viruses or pathogens and corresponding cytokine production induces NKG2D-ligand expression on dendritic cells and macrophages as well as NKG2D receptor upregulation on NK cells to initiate an immune response (1,2,4,6). Similarly, NKG2D-ligand expression on tumor cells is upregulated in cancers such as liver cancer, ovarian cancer, colon cancer, and leukemia, and the NKG2D/NKG2D-ligand signaling axis functions in preventing progression and metastasis (1,4,6). By contrast, NKG2D signaling also mediates tumor escape through ligand shedding via proteases from the matrix metalloproteinase (MMP) and a disintegrin and metalloprotease (ADAM) families and transforming growth factor (TGF)-beta inhibition of T cell and NK cell function (4). A number of therapeutic strategies targeting the NKG2D receptor-ligand pathway have been developed for cancer immunotherapies including upregulating NKG2D expression on immune cells via soluble cytokines, modulating ligand expression with histone deacetylase (HDAC) inhibitors, or inhibiting ligand shedding molecules like ADAMs and MMPs (1,4,6). Alternatively, in instances of autoimmune diseases or inflammation, NKG2D blocking strategies are of interest (6).

References

1. Wang, J., Li, C. D., & Sun, L. (2020). Recent Advances in Molecular Mechanisms of the NKG2D Pathway in Hepatocellular Carcinoma. Biomolecules, 10(2), 301. https://doi.org/10.3390/biom10020301

2. Stojanovic, A., Correia, M. P., & Cerwenka, A. (2018). The NKG2D/NKG2DL Axis in the Crosstalk Between Lymphoid and Myeloid Cells in Health and Disease. Frontiers in immunology, 9, 827. https://doi.org/10.3389/fimmu.2018.00827

3. Wensveen, F. M., Jelencic, V., & Polic, B. (2018). NKG2D: A Master Regulator of Immune Cell Responsiveness. Frontiers in immunology, 9, 441. https://doi.org/10.3389/fimmu.2018.00441

4. Liu, H., Wang, S., Xin, J., Wang, J., Yao, C., & Zhang, Z. (2019). Role of NKG2D and its ligands in cancer immunotherapy. American journal of cancer research, 9(10), 2064-2078.

5. Uniprot (P26718)

6. Lanier L. L. (2015). NKG2D Receptor and Its Ligands in Host Defense. Cancer immunology research, 3(6), 575-582. https://doi.org/10.1158/2326-6066.CIR-15-0098

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2225
Species: Mu
Applications: AgAct, CyTOF-ready, Flow, IHC, WB
MAB1058
Species: Hu
Applications: Block, CyTOF-ready, Flow
202-IL
Species: Hu
Applications: BA
MAB1059
Species: Hu
Applications: CyTOF-ready, Flow
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
1849-NK
Species: Hu
Applications: BA
247-ILB
Species: Hu
Applications: BA
2249-NK
Species: Hu
Applications: BA
MAB1599
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, KO, WB
7268-CT
Species: Hu
Applications: BA
DY1298
Species: Hu
Applications: ELISA
MAB97861
Species: Hu
Applications: Flow, IHC,  IHC-P
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
AF2408
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
MAB1380
Species: Hu
Applications: Block, CyTOF-ready, Flow
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
MAB666
Species: Hu
Applications: CyTOF-ready, Flow, Neut, WB
NBP2-56979PEP
Species: Hu
Applications: AC

Publications for NKG2D/CD314 Recombinant Protein Antigen (NBP2-56979PEP) (0)

There are no publications for NKG2D/CD314 Recombinant Protein Antigen (NBP2-56979PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NKG2D/CD314 Recombinant Protein Antigen (NBP2-56979PEP) (0)

There are no reviews for NKG2D/CD314 Recombinant Protein Antigen (NBP2-56979PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NKG2D/CD314 Recombinant Protein Antigen (NBP2-56979PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NKG2D/CD314 Products

Research Areas for NKG2D/CD314 Recombinant Protein Antigen (NBP2-56979PEP)

Find related products by research area.

Blogs on NKG2D/CD314.

Harnessing Natural Killer Cell Activity for Anti-Tumor Immunotherapy
By Victoria Osinski, PhDWhat’s “Natural” About Natural Killer (NK) Cells?For immunologists, the term cytotoxicity often conjures up images of an army of antigen specific CD8+ T cells deploying to ...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NKG2D/CD314 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KLRK1