NKD1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: NKD1 Antibody [NBP2-30532] - Staining of human cell line Hep G2 shows localization to nucleoli fibrillar center & cytosol.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NKD1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NKD1 Antibody - BSA Free (NBP2-30532) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LRVKLTVAPDGSQSKRSVLVNQADLQSARPRAETKPTEDLRSWEKKQRAPLRFQGDSRLEQSGCYHHCVDENIE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NKD1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NKD1 Protein (NBP2-30532PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NKD1 Antibody - BSA Free

• Dvl-binding protein
• hNkd
• hNkd1
• naked cuticle homolog 1 (Drosophila)
• naked cuticle-1
• Naked1
• naked-1
• NKD
• protein naked cuticle homolog 1

Background

In the mouse, Nkd is a Dishevelled (see DVL1; MIM 601365)-binding protein that functions as a negative regulator of theWnt (see WNT1; MIM 164820)-beta-catenin (see MIM 116806)-Tcf (see MIM 602272) signaling pathway.(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NKD1
• Uniprot:
  • Q969G9(Human)