NKCC2/SLC12A1 Antibody - BSA Free

Western Blot: NKCC2/SLC12A1 Antibody [NBP1-57622] - Sample Tissue: Human A549 Antibody Dilution: 1.0 ug/ml

Immunohistochemistry: NKCC2/SLC12A1 Antibody [NBP1-57622] - Paraffin Embedded Tissue: Human Kidney Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X

Western Blot: NKCC2/SLC12A1 Antibody [NBP1-57622] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml

Western Blot: NKCC2/SLC12A1 Antibody [NBP1-57622] - Sample Tissue: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/lane, Gel Concentration: 0.12

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NKCC2/SLC12A1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SLC12A1(solute carrier family 12 (sodium/potassium/chloride transporters), member 1) The peptide sequence was selected from the N terminal of SLC12A1. Peptide sequence NEKKSRGFFNYQASIFAENFGPRFTKGEGFFSVFAIFFPAATGILAGANI The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC12A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
  • Western Blot 1.0 ug/ml
• Theoretical MW: 47 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NKCC2/SLC12A1 Antibody - BSA Free

• BSC1
• Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2
• Kidney-specific Na-K-Cl symporter
• MGC48843
• NKCC2
• NKCC2A variant A
• NKCC2Na-K-2Cl cotransporter
• SLC12A1
• solute carrier family 12 (sodium/potassium/chloride transporters), member 1
• solute carrier family 12 member 1

Background

The sodium-potassium-chloride cotransporter isoform 2 is kidney-specific and is found on the apical membrane of the thick ascending limb of Henle's loop and the macula densa. It accounts for most of the NaCl resorption with the stoichiometry of 1Na:1K:2Cl and is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NKCC2/SLC12A1 Antibody (NBP1-57622)(1)

Publication using NBP1-57622

• Toka HR, Al-Romaih K, Koshy JM et al. Deficiency of the calcium-sensing receptor in the kidney causes parathyroid hormone-independent hypocalciuria. J Am Soc Nephrol. 2012-11-01 [PMID: 22997254]

Bioinformatics

• Gene Symbol: SLC12A1
• Entrez:
  • 6557(Human)
• Uniprot:
  • Q8IUN5(Human)