NKCC1/SLC12A2 Antibody

Images

 
Immunohistochemistry: NKCC1/SLC12A2 Antibody [NBP1-89928] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NKCC1/SLC12A2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TLVLGFKKDWLQADMRDVDMYINLFHDAFDIQYGVVVIRLKEGLDISHLQGQEELLSSQEKSPGTKDVVVSVEYSKKSDLDTSKPLSE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC12A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NKCC1/SLC12A2 Protein (NBP1-89928PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NKCC1/SLC12A2 Antibody

  • Basolateral Na-K-Cl symporter
  • BSC
  • BSC2
  • Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 1
  • NKCC1
  • NKCC1MGC104233
  • SLC12A2
  • solute carrier family 12 (sodium/potassium/chloride transporters), member 2
  • solute carrier family 12 member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-57622
Species: Hu
Applications: WB, IHC, IHC-P
MAB8369
Species: Hu
Applications: WB, Flow, CyTOF-ready
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-48021
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86376
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83067
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009943-M16
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-91725
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82492
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NB600-284
Species: Hu, Mu, Rt
Applications: ICC/IF (-), WB, EM, IHC, IHC-Fr, IHC-P
NBP1-89282
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76847
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-85133
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB110-81529
Species: Hu, Mu, Rt, Op, Pm, Rb
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IP, IF
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-90225
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-89928
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for NKCC1/SLC12A2 Antibody (NBP1-89928) (0)

There are no publications for NKCC1/SLC12A2 Antibody (NBP1-89928).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NKCC1/SLC12A2 Antibody (NBP1-89928) (0)

There are no reviews for NKCC1/SLC12A2 Antibody (NBP1-89928). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NKCC1/SLC12A2 Antibody (NBP1-89928) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NKCC1/SLC12A2 Products

Bioinformatics Tool for NKCC1/SLC12A2 Antibody (NBP1-89928)

Discover related pathways, diseases and genes to NKCC1/SLC12A2 Antibody (NBP1-89928). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NKCC1/SLC12A2 Antibody (NBP1-89928)

Discover more about diseases related to NKCC1/SLC12A2 Antibody (NBP1-89928).
 

Pathways for NKCC1/SLC12A2 Antibody (NBP1-89928)

View related products by pathway.

Blogs on NKCC1/SLC12A2

There are no specific blogs for NKCC1/SLC12A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NKCC1/SLC12A2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC12A2
Entrez