NKCC1/SLC12A2 Antibody - BSA Free

Immunohistochemistry-Paraffin: NKCC1/SLC12A2 Antibody [NBP1-89928] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NKCC1/SLC12A2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TLVLGFKKDWLQADMRDVDMYINLFHDAFDIQYGVVVIRLKEGLDISHLQGQEELLSSQEKSPGTKDVVVSVEYSKKSDLDTSKPLSE
• Predicted Species: Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC12A2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NKCC1/SLC12A2 Protein (NBP1-89928PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NKCC1/SLC12A2 Antibody - BSA Free

• Basolateral Na-K-Cl symporter
• BSC
• BSC2
• Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 1
• NKCC1
• NKCC1MGC104233
• SLC12A2
• solute carrier family 12 (sodium/potassium/chloride transporters), member 2
• solute carrier family 12 member 2

Background

Belonging to the SLC12A transporter family, NKCC1 is located on the basolateral membrane of secretory epithelia. Playing an important role in ionic balance and cell volume, NKCC1 is an electrically silent transporter system that mediates sodium, potassium and chloride transport and reabsorption. NKCC1 has interaction with OXSR1, STK39, MAPK14, UBC and RANBP2. Diseases associated with NKCC1 include hearing loss, growth failure, bleeding, torticollis and small intestinal prolapse and Bartter disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC12A2