NK3R/TACR3/Neurokinin B Receptor Recombinant Protein Antigen

Images

 
There are currently no images for NK3R/TACR3/Neurokinin B Receptor Recombinant Protein Antigen (NBP1-82561PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NK3R/TACR3/Neurokinin B Receptor Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TACR3.

Source: E. coli

Amino Acid Sequence: MATLPAAETWIDGGGGVGADAVNLTASLAAGAATGAVETGWLQLLDQAGNLSSSPSALGLPVASPAPSQPWANLTNQFVQPSWRIALWS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TACR3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82561.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NK3R/TACR3/Neurokinin B Receptor Recombinant Protein Antigen

  • Neurokinin B Receptor
  • neurokinin beta receptor
  • Neuromedin-K Receptor
  • NK-3 receptor
  • NK3R
  • NK-3R
  • NK3RMGC148061
  • NKR
  • TAC3R
  • TAC3RL
  • tachykinin receptor 3MGC148060
  • TACR3

Background

The Neurokinins, also known as Tachykinins, belong to an evolutionary conserved family of peptide neurotransmitters that share a c-terminal sequence and have an established role in neurotransmission. The mammalian tachykinins include substance P (NK1), neurokinin A (NKA) and neurokinin B (NKB) which exert their effects by binding to specific receptors. Tachykinin peptides are important in the mediation of many physiological and pathological processes including inflammation, pain, migraine headache and allergy induced asthma.

Three tachykinin receptor types have been characterized, NK-1, NK-2 and NK-3 which have preferential affinities for SP, NKA and NKB respectively. All three receptors share a high degree of sequence homology, have seven transmembrane spanning domains and similar signal transduction mechanisms (e.g. G-protein coupled activation of phospholipase C).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NB300-201
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB300-119
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB300-201
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
MAB1058
Species: Hu
Applications: Block, CyTOF-ready, Flow
NBP3-14421
Species: Hu
Applications: IHC,  IHC-P
MAB4077
Species: Hu
Applications: IHC, WB
MAB1059
Species: Hu
Applications: CyTOF-ready, Flow
7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP1-19788
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P
NBP3-38024
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-46175
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB1225
Species: Hu
Applications: Block, CyTOF-reported, Flow
247-ILB
Species: Hu
Applications: BA
MAB20172
Species: Hu
Applications: CyTOF-reported, Neut, WB
MAB139
Species: Hu
Applications: CostimT, CyTOF-ready, Flow, Neut, WB
AF2408
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
NBP1-82561PEP
Species: Hu
Applications: AC

Publications for NK3R/TACR3/Neurokinin B Receptor Recombinant Protein Antigen (NBP1-82561PEP) (0)

There are no publications for NK3R/TACR3/Neurokinin B Receptor Recombinant Protein Antigen (NBP1-82561PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NK3R/TACR3/Neurokinin B Receptor Recombinant Protein Antigen (NBP1-82561PEP) (0)

There are no reviews for NK3R/TACR3/Neurokinin B Receptor Recombinant Protein Antigen (NBP1-82561PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NK3R/TACR3/Neurokinin B Receptor Recombinant Protein Antigen (NBP1-82561PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NK3R/TACR3/Neurokinin B Receptor Products

Research Areas for NK3R/TACR3/Neurokinin B Receptor Recombinant Protein Antigen (NBP1-82561PEP)

Find related products by research area.

Blogs on NK3R/TACR3/Neurokinin B Receptor

There are no specific blogs for NK3R/TACR3/Neurokinin B Receptor, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NK3R/TACR3/Neurokinin B Receptor Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TACR3