Nitrilase 1 Antibody (1C3)

Images

 
Western Blot: Nitrilase 1 Antibody (1C3) [H00004817-M01] - Analysis of NIT1 expression in transfected 293T cell line by NIT1 monoclonal antibody (M01), clone 1C3.Lane 1: NIT1 transfected lysate (Predicted MW: 35.9 ...read more
Immunocytochemistry/ Immunofluorescence: Nitrilase 1 Antibody (1C3) [H00004817-M01] - Analysis of monoclonal antibody to NIT1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunoprecipitation: Nitrilase 1 Antibody (1C3) [H00004817-M01] - Analysis of NIT1 transfected lysate using anti-NIT1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NIT1 monoclonal antibody.
Sandwich ELISA: Nitrilase 1 Antibody (1C3) [H00004817-M01] - Detection limit for recombinant GST tagged NIT1 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IP
Clone
1C3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Nitrilase 1 Antibody (1C3) Summary

Immunogen
NIT1 (NP_005591.1 228 a.a. - 327 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AFGSITGPAHWEVLLRARAIETQCYVVAAAQCGRHHEKRASYGHSMVVDPWGTVVARCSEGPGLCLARIDLNYLRQLRRHLPVFQHRRPDLYGNLGHPLS
Specificity
Reacts with nitrilase 1.
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NIT1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunoprecipitation
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Nitrilase 1 Antibody (1C3)

  • EC 3.5
  • MGC57670
  • nitrilase 1
  • nitrilase homolog 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02486
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89062
Species: Hu
Applications: WB, IHC, IHC-P
AF6144
Species: Hu
Applications: WB, Simple Western
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP1-57365
Species: Hu
Applications: WB
NB100-534
Species: Hu
Applications: WB, IP
NBP1-31070
Species: Hu
Applications: WB, ICC/IF
NBP2-13351
Species: Hu, ChHa
Applications: WB, IHC, IHC-P
AF6574
Species: Mu
Applications: WB
NBP1-83254
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Nitrilase 1 Antibody (H00004817-M01) (0)

There are no publications for Nitrilase 1 Antibody (H00004817-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nitrilase 1 Antibody (H00004817-M01) (0)

There are no reviews for Nitrilase 1 Antibody (H00004817-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Nitrilase 1 Antibody (H00004817-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Nitrilase 1 Products

Bioinformatics Tool for Nitrilase 1 Antibody (H00004817-M01)

Discover related pathways, diseases and genes to Nitrilase 1 Antibody (H00004817-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nitrilase 1 Antibody (H00004817-M01)

Discover more about diseases related to Nitrilase 1 Antibody (H00004817-M01).
 

Pathways for Nitrilase 1 Antibody (H00004817-M01)

View related products by pathway.

PTMs for Nitrilase 1 Antibody (H00004817-M01)

Learn more about PTMs related to Nitrilase 1 Antibody (H00004817-M01).

Blogs on Nitrilase 1

There are no specific blogs for Nitrilase 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nitrilase 1 Antibody (1C3) and receive a gift card or discount.

Bioinformatics

Gene Symbol NIT1
Entrez
Uniprot